DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dop1R1 and CG13579

DIOPT Version :9

Sequence 1:NP_001262563.1 Gene:Dop1R1 / 41726 FlyBaseID:FBgn0011582 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001261169.1 Gene:CG13579 / 37905 FlyBaseID:FBgn0035010 Length:716 Species:Drosophila melanogaster


Alignment Length:408 Identity:80/408 - (19%)
Similarity:141/408 - (34%) Gaps:116/408 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 VSIVVVGIFLSVLIFLSVAGNILVCLAIYTER---SLRRIGNLFLASLAIADLFVASLVMTFAGV 187
            ::..:..:.:.||....:..|.||...|...|   .:.:.....|.|||:.||.:..|:..|..:
  Fly    35 IAETIEAVLILVLTLGVIGANCLVIFVINNRRYAAYIHQQPRYLLTSLALNDLTIGLLITPFGLM 99

  Fly   188 NDLLGYWIFGAQFCDTWVAFDVMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAI 252
            ..|...|.:|..||..........|..|.:.|..:::|||:....|.||.:..:::..|..::..
  Fly   100 PALFHCWPYGEIFCQIQALLRGALSQQSAVILVCMAVDRYMCALHPRRYYQHSSKKGCVAILSLT 164

  Fly   253 WLLAAFV-SFVPISLGIHRPDQPLIFEDNGKKYPTC-ALDLTPTYAVVSSCISFYFPCVVMIGIY 315
            |:::..| .|:.:..|.:       |.:.|  ...| .....|:|.::|:| :.|||..:::   
  Fly   165 WIISLTVFGFLVLPKGYY-------FNNTG--LMACEPFYSKPSYRILSTC-ALYFPTTMVL--- 216

  Fly   316 CRLYCYAQK-HVKSIKA--VTRPGEVAEKQRYKSIRRPKNQPKKFKVRNLHTH------------ 365
              :|||... |:...:.  .|.|...|....:     |...|...:...:|.|            
  Fly   217 --MYCYGSSFHMSRFRLNDPTMPLTAAAHHPH-----PHPHPTAAQQLQMHQHQQHHQQAGMHSH 274

  Fly   366 ------------SSPYHVSDH-------------------------------------------- 374
                        |.|.|.:.|                                            
  Fly   275 LYHGHSHHPSHPSHPNHPNHHGHPHHHGPPVMGHLSMAMSMGLAGMPNMTNKITKKIVPIQEKNS 339

  Fly   375 -------KAAVTVGVIMGVFLICWVPFFCVNITAAFCKTCIGGQTFKIL----TWLGYSNSAFNP 428
                   .||:::|     |::...|:....|..|    |.|.:....|    ||...|||.:||
  Fly   340 SGSTSRSMAAISLG-----FIVMVTPWTIQEIVTA----CTGSKLPPFLDFLVTWTALSNSLWNP 395

  Fly   429 IIYSIFNKEFRDAFKRIL 446
            .:|.:.|.:||...::::
  Fly   396 FMYWLLNSDFRRMSRQLM 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dop1R1NP_001262563.1 7tm_4 134..>266 CDD:304433 33/135 (24%)
7tm_1 145..431 CDD:278431 74/372 (20%)
CG13579NP_001261169.1 7tm_4 51..>148 CDD:304433 25/96 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460607
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.