DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dop1R1 and HTR4

DIOPT Version :9

Sequence 1:NP_001262563.1 Gene:Dop1R1 / 41726 FlyBaseID:FBgn0011582 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001035263.1 Gene:HTR4 / 3360 HGNCID:5299 Length:428 Species:Homo sapiens


Alignment Length:382 Identity:131/382 - (34%)
Similarity:192/382 - (50%) Gaps:39/382 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 EMDTIVGEEPEPLSLVSIVVVGIFLSVLIFLSVAGNILVCLAIYTERSLRRI-GNLFLASLAIAD 174
            ::|..|..| |....|..||:..|||.:|.:::.||:||.:|:..:|.||:| .|.|:.|||.||
Human     3 KLDANVSSE-EGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIVSLAFAD 66

  Fly   175 LFVASLVMTFAGVNDLLGYWIFGAQFCDTWVAFDVMCSTASILNLCAISMDRYIHI-KDPLRYGR 238
            |.|:.|||.|..:..:...||:|..||....:.||:.:||||.:||.||:|||..| ..||.|..
Human    67 LLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRN 131

  Fly   239 WVTRRVAVITIAAIWLLAAFVSFVPI-----SLGIHRPDQPLIFEDNGKKYPTCALDLTPTYAVV 298
            .:|.....:.:...|::..|:||:||     ::||....:...|..|... ..|...:...||:.
Human   132 KMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSNS-TYCVFMVNKPYAIT 195

  Fly   299 SSCISFYFPCVVMIGIYCRLYCYAQKHVKSIKAVTRPGEVAEKQRYKSIRRPKNQPKKFKVRNLH 363
            .|.::||.|.::|:..|.|:|..|::|...|:.:.|.|..:|.       ||::..:        
Human   196 CSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSES-------RPQSADQ-------- 245

  Fly   364 THSSPYHVSDHKAAVTVGVIMGVFLICWVPFFCVNITAAFCKTCIGGQTFKILTWLGYSNSAFNP 428
             ||:....::.|||.|:.:|||.|.:||.|||..||...|....:.||.:....||||.||..||
Human   246 -HSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWLGYINSGLNP 309

  Fly   429 IIYSIFNKEFRDAFKRIL-----TMRNPWCCAQDV--------GNIHPRNSDRFITD 472
            .:|:..||.||.||..||     ..|.|....|.|        |:.|...:| |:.|
Human   310 FLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRTD-FLFD 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dop1R1NP_001262563.1 7tm_4 134..>266 CDD:304433 55/138 (40%)
7tm_1 145..431 CDD:278431 102/292 (35%)
HTR4NP_001035263.1 7tm_1 36..312 CDD:278431 102/292 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24247
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.