DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dop1R1 and mAChR-C

DIOPT Version :9

Sequence 1:NP_001262563.1 Gene:Dop1R1 / 41726 FlyBaseID:FBgn0011582 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_572358.1 Gene:mAChR-C / 31626 FlyBaseID:FBgn0029909 Length:371 Species:Drosophila melanogaster


Alignment Length:350 Identity:102/350 - (29%)
Similarity:146/350 - (41%) Gaps:89/350 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 VVVGIFLSVLIFLSVAGNILVCLAIYTERSLRR-IGNLFLASLAIADLFVASLVMTFAGV----N 188
            :.:..||.|||   :.||||..:|:.|.|.||. |.|||:.|||::| |...|.:.:..|    :
  Fly    54 LAINAFLFVLI---LGGNILTIVAVRTCRHLRSVISNLFILSLAVSD-FCVGLALPYHLVFYMGS 114

  Fly   189 D--------LLGYWIFGAQFCDTWVAFDVMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVA 245
            |        ||.:::.....|            .|:|.|.:|::||||.:...|.|.|::|||||
  Fly   115 DIGAMRGPCLLRFFLLICACC------------VSMLTLISIAVDRYIAVVYALHYRRYMTRRVA 167

  Fly   246 VITIAAIWLLAAFVSFVPISLGIHRPDQPLIFEDNGKKYPTCALD-----------LTPTYAVVS 299
            ...|...|.|.|.|:.:|            :|.:.......|..|           :||.:.::.
  Fly   168 YSIIIFNWCLGALVALLP------------VFWNRWPDAQACEFDEVLAPGYIAGVITPGFVIIW 220

  Fly   300 SCISFYFPCVVMIGIYCRLYCYAQKHVKSIKAVTRPGEVAEKQRYKSIRRPKNQPKKFKVRNLHT 364
            .|         |..:|.|:...|.|....::              :|:  ..|..:...:|||..
  Fly   221 IC---------MFLVYWRIMREASKQALRLR--------------QSV--VYNTDEATTMRNLLL 260

  Fly   365 HSSPYHVSDHKAAVTVGVIMGVFLICWVPFFCVNITAAFCKTCIGGQTFKILTWLGYSNSAFNPI 429
            |      .|.|:...|..|||.|.:||:|:|||.|...|.........:|....|..:|||.|||
  Fly   261 H------PDWKSVQIVVFIMGCFTLCWLPYFCVAIAQLFSICQSSSMIYKTTFSLAIANSALNPI 319

  Fly   430 IYSIFNKEFRDAFKRILTMRNPWCC 454
            |||..|..||.||.:.|      ||
  Fly   320 IYSWKNSGFRRAFVQTL------CC 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dop1R1NP_001262563.1 7tm_4 134..>266 CDD:304433 51/144 (35%)
7tm_1 145..431 CDD:278431 86/309 (28%)
mAChR-CNP_572358.1 7tm_4 61..332 CDD:304433 95/329 (29%)
7tm_1 67..321 CDD:278431 86/309 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460600
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.