DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dop1R1 and Olr1576

DIOPT Version :9

Sequence 1:NP_001262563.1 Gene:Dop1R1 / 41726 FlyBaseID:FBgn0011582 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001000499.1 Gene:Olr1576 / 304985 RGDID:1333702 Length:309 Species:Rattus norvegicus


Alignment Length:338 Identity:80/338 - (23%)
Similarity:133/338 - (39%) Gaps:81/338 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 IVVVGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFAGVNDLLG 192
            |.:..:||::.| |::|||.::....|.:|.|......||:.||.::. |.:||:....::.|:.
  Rat    25 ITLFVVFLTIYI-LTLAGNFIIVTITYMDRHLHTPMYFFLSMLASSET-VYTLVIVPRMLSSLIF 87

  Fly   193 YWI-FGAQFCDTWVAFDVMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLA 256
            |.: .....|.|.:.|.|..:|.:...|.|:..|||:.|.:||||...:::.:..      ||:.
  Rat    88 YDLPISLAGCATQMFFFVTLATNNCFLLTAMGYDRYVAICEPLRYTVIMSKGLCA------WLVC 146

  Fly   257 AFVSFVPISLGIHRPDQ---PL-------IFEDNGKKYPTCALDLTPTYAVVSSCISF---YFPC 308
            ..:....:...:|.|..   |.       .|.|   .||...|....|  .|:..|::   .|..
  Rat   147 GSLGTGLVMAVLHVPAMFHLPFCGTVVEHFFCD---IYPVMKLSCVDT--TVNEIINYGVSSFVI 206

  Fly   309 VVMIGIYCRLYCYAQKHVKSIKAVTRPGEVAEKQRYKSIRRPKNQPKKFKVRNLHTHSSPYHVSD 373
            :|.||:....|......:  :|.|:..|                |.|.|.....|          
  Rat   207 LVPIGLIFISYVLIVSSI--LKIVSTEG----------------QKKAFATCASH---------- 243

  Fly   374 HKAAVTVGVIMGVFLICWVPFFCVNIT-------AAFCKTCIGGQTFKILTWLGYSNSAFNPIIY 431
                :||.:         |.:.|.:|.       ::..|..:...|:.|:|.|      .||::|
  Rat   244 ----LTVVI---------VHYGCASIAYLKPKSESSVEKDLLLSVTYIIITPL------LNPVVY 289

  Fly   432 SIFNKEFRDAFKR 444
            |:.|||.:||..|
  Rat   290 SLRNKEVKDALCR 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dop1R1NP_001262563.1 7tm_4 134..>266 CDD:304433 36/132 (27%)
7tm_1 145..431 CDD:278431 66/306 (22%)
Olr1576NP_001000499.1 7tm_4 31..303 CDD:304433 79/332 (24%)
7tm_1 41..289 CDD:278431 66/306 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24247
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.