DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dop1R1 and Olr1095

DIOPT Version :9

Sequence 1:NP_001262563.1 Gene:Dop1R1 / 41726 FlyBaseID:FBgn0011582 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001000416.1 Gene:Olr1095 / 299576 RGDID:1333565 Length:318 Species:Rattus norvegicus


Alignment Length:365 Identity:80/365 - (21%)
Similarity:135/365 - (36%) Gaps:90/365 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 SWTNASEMDTIVGEEPEP-LSLVSIVVVGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLA 168
            ::|..||. .::|....| |.|:..:   :||.:.:| ::.||:|:...|::|.||......||.
  Rat     8 NYTFVSEF-ILIGFSTFPHLQLMFFL---LFLLMYLF-TLLGNLLIMATIWSEHSLHTPMYRFLC 67

  Fly   169 SLAIADLFVASLVMTFAGVNDLLGYWI-----FGAQFCDTWVAFDVMCSTASILNLCAISMDRYI 228
            :|:|:::|     .|||.:..:|...:     .....|.:.:.|..|........|..:..|||:
  Rat    68 ALSISEIF-----YTFAIIPRMLADLLSALHSIALLACASQMFFSFMFGFTHSFLLTVMGYDRYV 127

  Fly   229 HIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVPIS---------------LGIHRPDQPLIFE 278
            .|..||||...::.|.....:|..|:..:|:..|..:               ...|.|  ||:..
  Rat   128 AICHPLRYNVLMSPRGCACLVAWSWVGGSFMGTVVTTAIFNLTFCGPSEIHHFACHVP--PLLKL 190

  Fly   279 DNGKKYPTCALDLTPTYAVVSSCISFYFPCVVMIGIYCRLYCYAQKHVKSIKAVTRPGEVAEKQR 343
            ..||..      |.....|...||:....|.::|     |..||......:|..:..|.      
  Rat   191 ACGKNV------LAVAKGVGMVCITALLGCFLLI-----LLSYAFIVATILKIPSAEGR------ 238

  Fly   344 YKSIRRPKNQPKKFKVRNLHTHSSPYHVSDHKAAVTVGVIMGVFLICWVPFFCVNITAAFCKTCI 408
                                          |||..|....:.|.::.:.....:.:.....|:..
  Rat   239 ------------------------------HKAFSTCASHLTVVVVHYGFASVIYLKPKGPKSLE 273

  Fly   409 G----GQTFKILTWLGYSNSAFNPIIYSIFNKEFRDAFKR 444
            |    |.|:.:||      ...:|||:|:.|||.::|.|:
  Rat   274 GDTLMGITYTVLT------PFLSPIIFSLRNKELKNAMKK 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dop1R1NP_001262563.1 7tm_4 134..>266 CDD:304433 36/151 (24%)
7tm_1 145..431 CDD:278431 63/309 (20%)
Olr1095NP_001000416.1 7tm_4 44..312 CDD:304433 70/324 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24247
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.