DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dop1R1 and Olr519

DIOPT Version :9

Sequence 1:NP_001262563.1 Gene:Dop1R1 / 41726 FlyBaseID:FBgn0011582 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001000318.1 Gene:Olr519 / 295772 RGDID:1334112 Length:322 Species:Rattus norvegicus


Alignment Length:353 Identity:72/353 - (20%)
Similarity:117/353 - (33%) Gaps:118/353 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 IFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVAS-----LVMTFAGVN---D 189
            :||.:.:| ::.||..:.:.:..:..|......||:.|:..|...::     :::.|...|   .
  Rat    42 LFLDIYLF-TLIGNFGLVVLVIGDCRLHNPMYYFLSVLSFLDACYSTAVTPKMLVNFLNENKSIS 105

  Fly   190 LLGYWIFGAQFCDTWVAFDVMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAA--- 251
            |||        |.|.:...|...|.....|.|::.|||:.|.:||.|...::.||.:..|.|   
  Rat   106 LLG--------CATQMLLFVSLGTTESFLLAAMAYDRYVAIYNPLLYAVIMSPRVYLPLIIASYA 162

  Fly   252 -------IWLLAAF-VSF------------VPISLGIHRPDQPLIFEDNGKKYPTCALDLTPTYA 296
                   |..:|.| :||            :|..|.:...|             |...:|...|.
  Rat   163 GGVVHGVIHTVATFSLSFCGSNEIRHVFCDIPALLALSCSD-------------TRTNELLLMYL 214

  Fly   297 VVSSCISFYFPCVVMIGIYCRLYCYAQKHVKSIKAVTRPGEVAEKQRYKSIRRPKNQPKKFKVRN 361
            |  ..|......:|::.....|:.....|            .||.:|           |.|....
  Rat   215 V--GLIEAVTILIVLVSYGLILFAILNMH------------SAEGRR-----------KVFSTCG 254

  Fly   362 LH-THSSPYH--------VSDHKAAVTVGVIMGVFLICWVPFFCVNITAAFCKTCIGGQTFKILT 417
            .| |..|.||        .|....|....:::.:|....:|.                       
  Rat   255 SHLTGVSIYHGTILFSYMKSSSSYASNHDMVVSIFYTIVIPM----------------------- 296

  Fly   418 WLGYSNSAFNPIIYSIFNKEFRDAFKRI 445
                    .||||||:.||:.::|.|::
  Rat   297 --------LNPIIYSLRNKDVKEAMKKL 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dop1R1NP_001262563.1 7tm_4 134..>266 CDD:304433 38/162 (23%)
7tm_1 145..431 CDD:278431 62/325 (19%)
Olr519NP_001000318.1 7tm_4 51..316 CDD:304433 69/341 (20%)
7tm_1 53..302 CDD:278431 62/325 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24247
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.