DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dop1R1 and Olr515

DIOPT Version :9

Sequence 1:NP_001262563.1 Gene:Dop1R1 / 41726 FlyBaseID:FBgn0011582 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001000315.1 Gene:Olr515 / 295768 RGDID:1333988 Length:321 Species:Rattus norvegicus


Alignment Length:356 Identity:67/356 - (18%)
Similarity:116/356 - (32%) Gaps:124/356 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 IFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLV-----MTFAGVNDLLG 192
            :||::.:| ::.||..:.:.:..:..|......||:.|:..|...:::|     :.|...|..:.
  Rat    40 LFLAIYLF-TLIGNFGLVILVIGDCRLHNPMYYFLSVLSFLDACYSTVVTPKMLVNFLNENKSIS 103

  Fly   193 YWIFGAQFCDTWVAFDVMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITI-------- 249
            :..     |.|.:...|...|.....|.|::.|||:.|.:||.|...::.||.:..|        
  Rat   104 FLA-----CATQMLLFVTLGTTECFLLAAMAYDRYVAIYNPLLYTVTMSPRVYLPLIIASYTGGV 163

  Fly   250 --AAIWLLAAF-VSF------------VPISLGIHRPDQPLIFEDNGKKYPTCALDLTPTYAVVS 299
              .||..:|.| :||            :|..|.:...|             |...:|...|.|  
  Rat   164 MHGAIHTVATFSLSFCGSNEIRHVFCDIPALLALSCSD-------------TRTNELLLLYLV-- 213

  Fly   300 SCISFYFPCVVMIGIYCRLYCYAQKHVKSIKAVTRPGEVAEKQRYKSIRRPKNQPKKFKVRNLH- 363
            ..|......:|::.....|:.....|                       ..:.:.|.|.....| 
  Rat   214 GLIEIVTILIVLVSYGFILFAILNMH-----------------------STEGRRKVFSTCGSHL 255

  Fly   364 THSSPYH--------------VSDHKAAVTVGVIMGVFLICWVPFFCVNITAAFCKTCIGGQTFK 414
            |..|.||              .|:|      .:::.:|....:|.                    
  Rat   256 TGVSIYHGTILFSYMRPSSSYASNH------DMVVSIFYTIVIPM-------------------- 294

  Fly   415 ILTWLGYSNSAFNPIIYSIFNKEFRDAFKRI 445
                       .||||||:.||:.::|.|::
  Rat   295 -----------LNPIIYSLRNKDVKEAMKKL 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dop1R1NP_001262563.1 7tm_4 134..>266 CDD:304433 36/159 (23%)
7tm_1 145..431 CDD:278431 57/328 (17%)
Olr515NP_001000315.1 7tm_4 49..314 CDD:304433 64/344 (19%)
7tm_1 51..300 CDD:278431 57/328 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24247
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.