DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dop1R1 and OR10H5

DIOPT Version :9

Sequence 1:NP_001262563.1 Gene:Dop1R1 / 41726 FlyBaseID:FBgn0011582 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001004466.1 Gene:OR10H5 / 284433 HGNCID:15389 Length:315 Species:Homo sapiens


Alignment Length:362 Identity:80/362 - (22%)
Similarity:130/362 - (35%) Gaps:88/362 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 TNASEMDTIVGEEPEP-LSLVSIVVVGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASL 170
            |:.||. .:||....| |.|:..:   :||.:.:| ::.||:|:...:::||||.....|||.:|
Human     7 TSVSEF-ILVGFSAFPHLQLMLFL---LFLLMYLF-TLLGNLLIMATVWSERSLHMPMYLFLCAL 66

  Fly   171 AIADL---------FVASLVMTFAGVNDLLGYWIFGAQFCDTWVAFDVMCSTASILNLCAISMDR 226
            :|.::         .:|.|:.|...:..|.         |.:.:.|...........|..:..||
Human    67 SITEILYTVAIIPRMLADLLSTQRSIAFLA---------CASQMFFSFSFGFTHSFLLTVMGYDR 122

  Fly   227 YIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVPISLGIHRPDQPLIFEDNGKKY------- 284
            |:.|..||||...::.|.....:...|.....:..|..|...|     |.|..:.:.:       
Human   123 YVAICHPLRYNVLMSLRGCTCRVGCSWAGGLVMGMVVTSAIFH-----LAFCGHKEIHHFFCHVP 182

  Fly   285 PTCALDLTPTYAVVSS-----CISFYFPCVVMIGIYCRLYCYAQKHVKSIKAVTRPGEVAEKQRY 344
            |...|.......||:.     ||:....|.::|     |..||......:|..:..|        
Human   183 PLLKLACGDDVLVVAKGVGLVCITALLGCFLLI-----LLSYAFIVAAILKIPSAEG-------- 234

  Fly   345 KSIRRPKNQPKKFKVRNLHTHSSPYHVSDHKAAVTV--GVIMGVFLICWVPFFCVNITAAFCKTC 407
                    :.|.|..           .:.|...|.|  |....::|....|......|       
Human   235 --------RNKAFST-----------CASHLTVVVVHYGFASVIYLKPKGPQSPEGDT------- 273

  Fly   408 IGGQTFKILTWLGYSNSAFNPIIYSIFNKEFRDAFKR 444
            :.|.|:.:||      ...:|||:|:.|||.:.|.|:
Human   274 LMGITYTVLT------PFLSPIIFSLRNKELKVAMKK 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dop1R1NP_001262563.1 7tm_4 134..>266 CDD:304433 33/140 (24%)
7tm_1 145..431 CDD:278431 62/308 (20%)
OR10H5NP_001004466.1 7tm_4 41..304 CDD:304433 68/321 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.