DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dop1R1 and OR10H3

DIOPT Version :9

Sequence 1:NP_001262563.1 Gene:Dop1R1 / 41726 FlyBaseID:FBgn0011582 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_039226.1 Gene:OR10H3 / 26532 HGNCID:8174 Length:316 Species:Homo sapiens


Alignment Length:379 Identity:74/379 - (19%)
Similarity:120/379 - (31%) Gaps:150/379 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 PLSLVSIVVVGIFLSVLIFL-SVAGNILVCLAIYTERSLRRIGNLFLASLAIADL---------F 176
            |..|:.::   ..|.:|:|| ::.||:|:...::.||.|.....|||.:|:|:::         .
Human    21 PQQLLPVL---FLLYLLMFLFTLLGNLLIMATVWIERRLHTPMYLFLCALSISEILFTVAITPRM 82

  Fly   177 VASLVMTFAGVNDLLGYWIFGAQFCDTWVAFDVMCSTASILNLCAISMDRYIHIKDPLRYGRWVT 241
            :|.|:.|...:.       |.|  |...:.|..|........|..:..|.|:.|..||.|...::
Human    83 LADLLFTHRSIT-------FVA--CAIQMFFSFMFGFTHSFLLMVMGYDHYVTICHPLHYNMLMS 138

  Fly   242 RRVAVITIAAIWLLAAFVSFVPISLGIHRPDQPLIFEDNGKKYPTCALDLTPTYAVVSSCISFYF 306
            .|.....:|..|...:.:..:...:..|     |.|         |           .|.:..:|
Human   139 PRGCAHLVAWTWAGGSVMGMMVTMMVFH-----LTF---------C-----------GSNVIHHF 178

  Fly   307 PCVVMIGIYCRLYCYAQKHVKSIKAVTRPGEVAEKQRYKSIRRPKNQPKKFKVRNLHTHSSPYHV 371
            .|.|:  ...:|.|                                                   
Human   179 LCHVL--SLLKLAC--------------------------------------------------- 190

  Fly   372 SDHKAAVTVGVIMGVFLICWVPFF-C--------VNITAAFCK------------TCIGGQT--- 412
                .:.|..|||||.|:|..... |        |.|.||..:            ||:...|   
Human   191 ----GSKTSSVIMGVMLVCVTALIGCLFLIILSFVFIVAAILRIPSAEGRHKTFSTCVSHLTVVV 251

  Fly   413 ----FKILTWLG-------YSNSA-----------FNPIIYSIFNKEFRDAFKR 444
                |..|.:|.       ||::.           .:|||:|:.|||.::|..:
Human   252 MHYSFASLIYLKPKGLHSMYSDALMATTYTVFTPFLSPIIFSLRNKELKNAINK 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dop1R1NP_001262563.1 7tm_4 134..>266 CDD:304433 33/141 (23%)
7tm_1 145..431 CDD:278431 62/340 (18%)
OR10H3NP_039226.1 7tm_4 42..310 CDD:304433 68/355 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.