DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dop1R1 and Olfr509

DIOPT Version :9

Sequence 1:NP_001262563.1 Gene:Dop1R1 / 41726 FlyBaseID:FBgn0011582 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_666484.1 Gene:Olfr509 / 258369 MGIID:3030343 Length:321 Species:Mus musculus


Alignment Length:362 Identity:71/362 - (19%)
Similarity:128/362 - (35%) Gaps:94/362 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 PEPLSLVSIVVVGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTF 184
            ||..:|:.:||:...:::::     .|..:.:||....:|......||.:|:.::.....:::..
Mouse    19 PELHNLLFVVVLLSHVTIIL-----ANAFIMVAIKLNHNLHAPMYFFLFALSFSETCTTMVILPR 78

  Fly   185 AGVNDLLGYWIFGAQFCDTWVAFDVMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITI 249
            ..|:.:..........|.|.:.|.......:...|.|:|.|||..|.:||.|...:|:::.:..|
Mouse    79 LLVDLISKNKAISLPECATQMFFFFGLGGNNCFILSAMSYDRYTAIHNPLHYPILMTQKICLHLI 143

  Fly   250 AAIWLLAAFVSFVPISLGIHRPDQPLIFEDNGKKYPTCALDLTPTYAVVSSCISFYFPCVV--MI 312
            .|..:|...:|.                         |.:......:..:|.|..:|.|.:  ::
Mouse   144 VASGVLGFSISL-------------------------CIVITIFNLSFCNSNIIQHFFCDIDPVV 183

  Fly   313 GIYCRLYCYAQKHVKSIKAVTRPGEV------------------AEKQRYKSIRRPKNQPKKFKV 359
            .:.|.|..|.:..:.::.|....|..                  :.|.|||              
Mouse   184 SLACNLTFYHKVILFALTAFVLVGSFIFIMVSYVFIVTVVIKMPSAKGRYK-------------- 234

  Fly   360 RNLHTHSSPYHVSDHKAAVTVGVIMGVFLICWVPFFCVNITAAFCKTCIGGQTFKILTWLGYSNS 424
                |.|:   .|.|...|.:......|:     :.....:.:|....:...|:.|||.|     
Mouse   235 ----TFST---CSSHFTVVFIHYGFASFV-----YLRPKNSYSFRDATLLAVTYTILTPL----- 282

  Fly   425 AFNPIIYSIFNKEFRDAFKRILTMRNPWCCAQDVGNI 461
             .||||||:.||..:.|.|:            |:|||
Mouse   283 -LNPIIYSLRNKGIQTALKK------------DIGNI 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dop1R1NP_001262563.1 7tm_4 134..>266 CDD:304433 26/131 (20%)
7tm_1 145..431 CDD:278431 55/305 (18%)
Olfr509NP_666484.1 7tm_4 33..301 CDD:304433 61/329 (19%)
7tm_1 40..288 CDD:278431 55/304 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.