DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dop1R1 and Olfr1094

DIOPT Version :9

Sequence 1:NP_001262563.1 Gene:Dop1R1 / 41726 FlyBaseID:FBgn0011582 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_666477.1 Gene:Olfr1094 / 258362 MGIID:3030928 Length:330 Species:Mus musculus


Alignment Length:350 Identity:75/350 - (21%)
Similarity:121/350 - (34%) Gaps:107/350 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 LSVLIFL--------SVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFAGVNDLL 191
            |.||:||        ::.||:.:.|.:..:..|......||:.|:..|...:::|.....||.:.
Mouse    35 LQVLLFLLFFVIYLFTLIGNLGLVLLVIGDSRLHNPMYYFLSVLSFLDACYSTVVTPKMLVNFIS 99

  Fly   192 GYWIFGAQFCDTWVAFDVMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAV---------- 246
            .........|.|.:...|...|.....|.|::.||::.|.:||.|...::.||.:          
Mouse   100 NDKSISYPGCVTEMFLFVTFGTTECFLLAAMAYDRFVAIYNPLLYAVKMSPRVYIPLIIACYSGG 164

  Fly   247 ITIAAIWLLAAF-VSFVPISLGIHRPDQPLIFEDNGKKYPTCALDLTPTYAV------VSSCISF 304
            |..|.|..:|.| :||.               ..|..::..|  |:.|..|:      ::..:.|
Mouse   165 IMHATIHTVATFSLSFC---------------ASNEIRHVFC--DIPPLLAISCSNTNINQLLLF 212

  Fly   305 YFPCVVMIGIYCRL-----YCYAQKHVKSIKAVTRPGEVAEKQRYKSIRRPKNQPKKFKVRNLH- 363
            |  ||..|.|...|     |.:....:..:.:       ||.:|           |.|.....| 
Mouse   213 Y--CVGSIEIITILIVLVSYSFILFAILKMNS-------AEGRR-----------KIFSTCGSHL 257

  Fly   364 THSSPYHVS--------DHKAAVTVGVIMGVFLICWVPFFCVNITAAFCKTCIGGQTFKILTWLG 420
            |..|.||.:        ....|:...:|:..|....:|.                          
Mouse   258 TGVSIYHGTILFMYVRPSSNYALEHDMIVSTFYTIVIPM-------------------------- 296

  Fly   421 YSNSAFNPIIYSIFNKEFRDAFKRI 445
                 .||||||:.||:.::|.|:|
Mouse   297 -----LNPIIYSLRNKDVKEAMKKI 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dop1R1NP_001262563.1 7tm_4 134..>266 CDD:304433 37/149 (25%)
7tm_1 145..431 CDD:278431 62/316 (20%)
Olfr1094NP_666477.1 7tm_4 51..317 CDD:304433 69/333 (21%)
7tm_1 53..302 CDD:278431 62/316 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.