DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dop1R1 and Olfr479

DIOPT Version :9

Sequence 1:NP_001262563.1 Gene:Dop1R1 / 41726 FlyBaseID:FBgn0011582 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001011742.1 Gene:Olfr479 / 257891 MGIID:3030313 Length:327 Species:Mus musculus


Alignment Length:368 Identity:78/368 - (21%)
Similarity:147/368 - (39%) Gaps:77/368 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 TTLTSF--YNESSWTNASEMDTIVGEEPEPLSLVSIVVVGIFLSVLIFLSVAGNILVCLAIYTER 157
            :|:|:|  :..||:             ||..:|:.:|::...:::|:     .|..:.:||....
Mouse     5 STVTTFLLWGFSSF-------------PELHNLLFVVILLSHVTILL-----ANASIMVAIKLNH 51

  Fly   158 SLRRIGNLFLASLAIADLFVASLVMTFAGVNDLLGYWIFGAQFCDTWVAFDVMCSTASILNLCAI 222
            :|......||.:|:.::.....:::....|:.|..........|.|.:.|....:..:...:.|:
Mouse    52 NLHTPMYFFLFALSFSETCTTMVILPRMLVDLLSESKAISLPECATQMFFFFGLAANNCFIMAAM 116

  Fly   223 SMDRYIHIKDPLRYGRWVTRRV-AVITIAAIWLLAAFVSFVPISLGIHRPDQPLIFEDNGKKYPT 286
            |.|||..|..||.|..::|.:| :.:.||:  .:..|:..:.|:..|..    |.|.|: |....
Mouse   117 SYDRYTAIHSPLHYHIFMTPKVCSQLVIAS--CVVGFLCSLSITFTIFN----LSFCDS-KTIQH 174

  Fly   287 CALDLTP------TYAVVSSCISFYFPCVVMIGIYCRL---YCYAQKHVKSIKAVTRPGEVAEKQ 342
            ...|::|      .|....:.|.|.....|::|.:..:   |.:....|..:.:|          
Mouse   175 FFCDISPLVHLACDYTAHHAMIIFMVSAFVLVGSFVLIMISYAFIVFLVVKMPSV---------- 229

  Fly   343 RYKSIRRPKNQPKKFKVRNLHTHSSPYHVSDHKAAVTVGVIMGVFLICWVPFFCVNITAAFCKTC 407
                    :.:.|.|...:.|              :|| |.|.....|:|.....| :.:|.:..
Mouse   230 --------QGRHKAFSTCSSH--------------LTV-VSMHYGFACFVYLIPKN-SDSFREDM 270

  Fly   408 IGGQTFKILTWLGYSNSAFNPIIYSIFNKEFRDAFKRILTMRN 450
            :...|:.:||.|      .|||:||:.|||.:.|.:::|:..|
Mouse   271 LMAVTYTVLTPL------LNPIVYSLRNKEMQTALRKVLSSIN 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dop1R1NP_001262563.1 7tm_4 134..>266 CDD:304433 28/132 (21%)
7tm_1 145..431 CDD:278431 60/295 (20%)
Olfr479NP_001011742.1 7tm_4 31..304 CDD:304433 67/324 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.