DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dop1R1 and Olfr1102

DIOPT Version :9

Sequence 1:NP_001262563.1 Gene:Dop1R1 / 41726 FlyBaseID:FBgn0011582 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_997037.2 Gene:Olfr1102 / 228228 MGIID:3030936 Length:324 Species:Mus musculus


Alignment Length:397 Identity:89/397 - (22%)
Similarity:133/397 - (33%) Gaps:122/397 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 TNGYDGTTLTSFYNESSWTNASEMDTIVGEEPEPLSLVSIVVVGIFLSVLIFLSVAGNILVCLAI 153
            |..|..|..|..      .|.:|:...:     .|.....|.:.|||.:|.           |||
Mouse     4 TPSYTNTKTTQV------NNVTEITVFI-----LLGFTDDVDMNIFLFILF-----------LAI 46

  Fly   154 YTERSLRRIGNLFLASLAIAD-----------------------LFVASLVMTFAGVNDLLGYWI 195
            |.   :..||||.|..|.|.|                       :....:::.|...|..:.:  
Mouse    47 YV---VTLIGNLGLVVLVIEDSRLHNPMYYFLTVLSSLDACFSSVLTPKMLVNFLSKNKSISF-- 106

  Fly   196 FGAQFCDTWVAFDVMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAV----------ITIA 250
               ..|.|.:...|...|.....|.|::.|||:.|..||.|...::.||.|          |..|
Mouse   107 ---AGCATQMLLFVTFGTTECFLLAAMAYDRYLAIYSPLLYAVRMSPRVYVPLIIASYTGGILHA 168

  Fly   251 AIWLLAAF-VSFVPISLGIHRPDQPLIFEDNGKKYPTCALDLTPTYAVVSSCISFYFPC---VVM 311
            .|..:|.| :||...:...|      :|.|..   |..||..:.|:  ::..:.||  |   :.:
Mouse   169 TIHTVATFSLSFCGSNEIRH------VFCDIP---PLLALSCSDTH--LNQLLLFY--CAGSIEL 220

  Fly   312 IGIYCRLYCYAQKHVKSIKAVTRPGEVAEKQRYKSIRRPKNQPKKFKVRNLH-THSSPYHVSDHK 375
            |.|...|..|....:..:|                |...:.:.|.|.....| |..|.:|     
Mouse   221 ITILIVLVSYGFVLLAILK----------------INSAEGRRKIFSTCGAHLTGVSIFH----- 264

  Fly   376 AAVTVGVIMGVFLICWV-PFFCVNITAAFCKTCIGGQTFKILTWLGYSNSAFNPIIYSIFNKEFR 439
                     |..|..:| |  ..|.|..        |...:.|:........||||||:.||:.:
Mouse   265 ---------GTILFMYVRP--SSNYTLE--------QDMVVSTFYTIVIPMLNPIIYSLRNKDVK 310

  Fly   440 DAFKRIL 446
            :|.:::|
Mouse   311 EAMRKLL 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dop1R1NP_001262563.1 7tm_4 134..>266 CDD:304433 40/165 (24%)
7tm_1 145..431 CDD:278431 70/324 (22%)
Olfr1102NP_997037.2 7tm_4 43..320 CDD:304433 77/347 (22%)
7tm_1 53..302 CDD:278431 65/306 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.