DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dop1R1 and OR5T2

DIOPT Version :9

Sequence 1:NP_001262563.1 Gene:Dop1R1 / 41726 FlyBaseID:FBgn0011582 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001004746.2 Gene:OR5T2 / 219464 HGNCID:15296 Length:318 Species:Homo sapiens


Alignment Length:345 Identity:73/345 - (21%)
Similarity:126/345 - (36%) Gaps:102/345 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 IFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLV-----MTFAGVNDLLG 192
            :||::.:| ::.||:.:.|.:..:..|.:....||:.|:..|...:|::     :.|...|.::.
Human    28 LFLAIYLF-TLMGNLGLILVVIRDSQLHKPMYYFLSMLSSVDACYSSVITPNMLVDFTTKNKVIS 91

  Fly   193 YWIFGAQFCDTWVAFDVMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRR----------VAVI 247
            :  .|   |...|.......|.....|.|::.|||:.|.:||.|...::.|          ||.|
Human    92 F--LG---CVAQVFLACSFGTTECFLLAAMAYDRYVAIYNPLLYSVSMSPRVYMPLINASYVAGI 151

  Fly   248 TIAAIWLLAAF-VSFVPISLGIHRPDQPLIFEDNGKKYPTCALDLTPTYAVVSSCISFYF-PCVV 310
            ..|.|..:|.| :||...: .|.|     :|.|..   |..|:..:.|:  .:..:.||| ..:.
Human   152 LHATIHTVATFSLSFCGAN-EIRR-----VFCDIP---PLLAISYSDTH--TNQLLLFYFVGSIE 205

  Fly   311 MIGIYCRLYCYAQKHVKSIKAVTRPGEVAEKQRYKSIRRPKNQPKKFKVRNLH------------ 363
            ::.|...|..|....:..:|..:..|           ||     |.|.....|            
Human   206 LVTILIVLISYGLILLAILKMYSAEG-----------RR-----KVFSTCGAHLTGVSIYYGTIL 254

  Fly   364 ---THSSPYHVSDHKAAVTVGVIMGVFLICWVPFFCVNITAAFCKTCIGGQTFKILTWLGYSNSA 425
               ...|..:.|||      .:|:.:|....:|.                               
Human   255 FMYVRPSSSYASDH------DMIVSIFYTIVIPL------------------------------- 282

  Fly   426 FNPIIYSIFNKEFRDAFKRI 445
            .||:|||:.||:.:|:.|::
Human   283 LNPVIYSLRNKDVKDSMKKM 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dop1R1NP_001262563.1 7tm_4 134..>266 CDD:304433 37/147 (25%)
7tm_1 145..431 CDD:278431 63/317 (20%)
OR5T2NP_001004746.2 7tm_GPCRs 23..301 CDD:421689 72/342 (21%)
TM helix 1 24..50 CDD:410628 6/22 (27%)
TM helix 2 57..83 CDD:410628 5/25 (20%)
TM helix 3 95..125 CDD:410628 8/29 (28%)
TM helix 4 138..159 CDD:410628 5/20 (25%)
TM helix 5 193..223 CDD:410628 6/29 (21%)
TM helix 6 230..260 CDD:410628 6/45 (13%)
TM helix 7 267..292 CDD:410628 10/61 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.