DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dop1R1 and DRD1

DIOPT Version :9

Sequence 1:NP_001262563.1 Gene:Dop1R1 / 41726 FlyBaseID:FBgn0011582 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_000785.1 Gene:DRD1 / 1812 HGNCID:3020 Length:446 Species:Homo sapiens


Alignment Length:483 Identity:167/483 - (34%)
Similarity:240/483 - (49%) Gaps:82/483 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 LLTNGYDGTTLTSFYNESSWTNASEMDTIVGEEPEPLSLVSIVVVGIFLSVLIFLSVAGNILVCL 151
            |.|:..|||.|           ..|.|..|.           ::...|||:||..::.||.|||.
Human     4 LNTSAMDGTGL-----------VVERDFSVR-----------ILTACFLSLLILSTLLGNTLVCA 46

  Fly   152 AIYTERSLR-RIGNLFLASLAIADLFVASLVMTFAGVNDLLGYWIFGAQFCDTWVAFDVMCSTAS 215
            |:...|.|| ::.|.|:.|||::||.||.|||.:..|.::.|:|.||: ||:.|||||:||||||
Human    47 AVIRFRHLRSKVTNFFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGS-FCNIWVAFDIMCSTAS 110

  Fly   216 ILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVPISLGIH--RPDQPLIFE 278
            |||||.||:|||..|..|.||.|.:|.:.|.|.|:..|.|:..:||:|:.|..|  :|..|  .:
Human   111 ILNLCVISVDRYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTSP--SD 173

  Fly   279 DN----GKKYPTCALDLTPTYAVVSSCISFYFPCVVMIGIYCRLYCYAQKHVKSIKAVTRPGEVA 339
            .|    .:....|...|:.|||:.||.||||.|..:||..|.|:|..|||.::.|.|:.|....|
Human   174 GNATSLAETIDNCDSSLSRTYAISSSVISFYIPVAIMIVTYTRIYRIAQKQIRRIAALERAAVHA 238

  Fly   340 EK-QRYKSIRRPK--NQPKKFKVRNLHTHSSPYHVS---DHKAAVTVGVIMGVFLICWVPFFCVN 398
            :. |......:|.  :||:           |.:.:|   :.|...|:.||||||:.||:|||.:|
Human   239 KNCQTTTGNGKPVECSQPE-----------SSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILN 292

  Fly   399 ITAAFCKT------CIGGQTFKILTWLGYSNSAFNPIIYSIFNKEFRDAFKRILTMRNPWCCAQD 457
            ....||.:      ||...||.:..|.|::||:.|||||: ||.:||.||..:|.... .|.|  
Human   293 CILPFCGSGETQPFCIDSNTFDVFVWFGWANSSLNPIIYA-FNADFRKAFSTLLGCYR-LCPA-- 353

  Fly   458 VGNIHPRNSDRFITDYAAKNVVVMNSGRS--SAELEQVSAIXPKCCLNLTGGGATWLPCGCGGLR 520
                         |:.|.:.|.:.|:|.:  |:..|...:|..:|.|      ...:|...|...
Human   354 -------------TNNAIETVSINNNGAAMFSSHHEPRGSISKECNL------VYLIPHAVGSSE 399

  Fly   521 VDDDDDGALTTRYVPXDSVTAATATIVE 548
            ....::.|...|  |.:.::.|.:.|::
Human   400 DLKKEEAAGIAR--PLEKLSPALSVILD 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dop1R1NP_001262563.1 7tm_4 134..>266 CDD:304433 68/132 (52%)
7tm_1 145..431 CDD:278431 125/304 (41%)
DRD1NP_000785.1 7tmA_D1A_dopamine_R 23..341 CDD:320443 136/343 (40%)
TM helix 1 26..50 CDD:320443 11/23 (48%)
TM helix 2 60..82 CDD:320443 12/21 (57%)
TM helix 3 97..119 CDD:320443 17/21 (81%)
TM helix 4 142..158 CDD:320443 6/15 (40%)
TM helix 5 192..215 CDD:320443 12/22 (55%)
TM helix 6 271..293 CDD:320443 12/21 (57%)
TM helix 7 310..335 CDD:320443 12/25 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 220 1.000 Domainoid score I2628
eggNOG 1 0.900 - - E33208_3B9BF
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 239 1.000 Inparanoid score I3358
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1045889at2759
OrthoFinder 1 1.000 - - FOG0001416
OrthoInspector 1 1.000 - - otm40833
orthoMCL 1 0.900 - - OOG6_107579
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4063
SonicParanoid 1 1.000 - - X883
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.760

Return to query results.
Submit another query.