DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dop1R1 and drd5a

DIOPT Version :9

Sequence 1:NP_001262563.1 Gene:Dop1R1 / 41726 FlyBaseID:FBgn0011582 Length:560 Species:Drosophila melanogaster
Sequence 2:XP_003199815.4 Gene:drd5a / 100536970 ZFINID:ZDB-GENE-130522-2 Length:281 Species:Danio rerio


Alignment Length:229 Identity:74/229 - (32%)
Similarity:106/229 - (46%) Gaps:23/229 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 VAVITIAAIWLLAAFVSFVPISLGIHRPDQPLIFEDNGKKYPTCALDLTPTYAVVSSCISFYFPC 308
            ||.:.|.|.|.|:..:||:|:.|..|:  ........|.....|...|...||:.||.||||.|.
Zfish     1 VAFVMIGAAWTLSVLISFIPVQLDWHK--AAARSGGGGGNAGDCDSSLNREYAISSSLISFYIPV 63

  Fly   309 VVMIGIYCRLYCYAQKHVKSIKAVTRPGEVAEKQRYKSIRRPKNQPKKFKVRNLHTHSSPYHVSD 373
            .:||..|.|:|..||..::.|.::.|..|.|:..|...:....:...|..:..           :
Zfish    64 AIMIVTYTRIYRIAQIQIRRIASLERAAEHAQSCRSNRLACQHHSSLKSSISR-----------E 117

  Fly   374 HKAAVTVGVIMGVFLICWVPFFCVNITAAFCK-------TCIGGQTFKILTWLGYSNSAFNPIIY 431
            .|...|:.||||||:.||:|||.:|....||.       .|:...||.:..|.|::||:.||:||
Zfish   118 TKVLKTLSVIMGVFVCCWLPFFVLNCVVPFCHDKPSAGLPCVSDTTFDVFVWFGWTNSSLNPVIY 182

  Fly   432 SIFNKEFRDAFKRILTMRNPWCCAQDVGNIHPRN 465
            : ||.|||..|..:|..|..  |...|..::..|
Zfish   183 A-FNAEFRKGFSSLLGCRGR--CRTPVETVNISN 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dop1R1NP_001262563.1 7tm_4 134..>266 CDD:304433 9/21 (43%)
7tm_1 145..431 CDD:278431 61/193 (32%)
drd5aXP_003199815.4 7tm_GPCRs <1..192 CDD:333717 68/204 (33%)
TM helix 4 4..20 CDD:320095 6/15 (40%)
TM helix 5 48..71 CDD:320095 11/22 (50%)
TM helix 6 118..143 CDD:320095 13/24 (54%)
TM helix 7 161..186 CDD:320095 11/25 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1045889at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.