DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dop1R1 and taar12m

DIOPT Version :9

Sequence 1:NP_001262563.1 Gene:Dop1R1 / 41726 FlyBaseID:FBgn0011582 Length:560 Species:Drosophila melanogaster
Sequence 2:XP_001920844.2 Gene:taar12m / 100150578 ZFINID:ZDB-GENE-100506-1 Length:349 Species:Danio rerio


Alignment Length:326 Identity:96/326 - (29%)
Similarity:150/326 - (46%) Gaps:41/326 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 VVVGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFAGVNDLLGY 193
            |.:.|.:.::|||:|.||:||.::|...:.|:...:|.:.|||..|..:.||||.::.|..:.|.
Zfish    43 VAMYILMLLIIFLTVFGNLLVVVSISYFKHLQSPTHLIVQSLAACDCLLGSLVMPYSMVRSIEGC 107

  Fly   194 WIFGAQFCDTWVAFDVMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAF 258
            |..|...|....:.|:..|.:|.::|..||:|||..|.|||.|...||.....:.|...||.|..
Zfish   108 WYLGDVICKVHSSLDMTLSISSKMHLSLISVDRYWAICDPLMYRTRVTNYSITVFIMCAWLFAFV 172

  Fly   259 VSFVPI-----SLGIHRPDQPLIFEDN--GKKYPTCALDLTPTYAVVSSCISFYFPCVVMIGIYC 316
            .||..:     .:|:    :.|:.:.:  |    :|.|......|::.|.::|:.|..:|..:|.
Zfish   173 YSFSIVFSEVNLIGL----EVLVLQISCLG----SCVLLFNKPSALICSILTFFLPGAIMSSLYV 229

  Fly   317 RLYCYAQKHVKSIKAVTRPGEVAEKQRYKSIRRPKNQPKKFKVRNLHTHSSPYHVSDHKAAVTVG 381
            :::..|.||.|.:..                          :|..|...|..|...:.|||..|.
Zfish   230 KIFRVASKHAKVLSE--------------------------RVSVLEIKSQTYAQRERKAAKIVA 268

  Fly   382 VIMGVFLICWVPFFCVNITAAFCKTCIGGQTFKILTWLGYSNSAFNPIIYSIFNKEFRDAFKRIL 446
            :::|.||:||:|||.......|.........|..|.|.||.||..||:||..|...|:.|||.::
Zfish   269 IVVGAFLLCWLPFFVATALDPFLDFWTPADVFDALVWFGYFNSTCNPLIYGFFYPRFQKAFKILM 333

  Fly   447 T 447
            :
Zfish   334 S 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dop1R1NP_001262563.1 7tm_4 134..>266 CDD:304433 46/136 (34%)
7tm_1 145..431 CDD:278431 83/292 (28%)
taar12mXP_001920844.2 7tm_1 59..318 CDD:278431 83/292 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24247
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.