DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dop1R1 and Olfr1564

DIOPT Version :9

Sequence 1:NP_001262563.1 Gene:Dop1R1 / 41726 FlyBaseID:FBgn0011582 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001185991.1 Gene:Olfr1564 / 100043474 MGIID:3782645 Length:318 Species:Mus musculus


Alignment Length:392 Identity:89/392 - (22%)
Similarity:151/392 - (38%) Gaps:111/392 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 SWTNASEMDTIVGEEPEP-LSLVSIVVVGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLA 168
            ::|..||. .::|....| |.|:..:   :||.:.:| ::.||:|:...|::|.||.....|||.
Mouse     8 NYTFVSEF-ILIGFSTFPHLQLMFFL---LFLLMYLF-TLLGNLLIMTTIWSEHSLHTPMYLFLC 67

  Fly   169 SLAIADLFVASLVMTFAGVNDLLGYWIFGAQFCDTW--VAFDVMCS-----------TASILNLC 220
            :|:|:::|     .|||.:..:|      |....|.  :|| :.|:           |.|.| |.
Mouse    68 ALSISEIF-----YTFAIIPRML------ADLLSTLHSIAF-LACASQMFFSFTFGFTHSFL-LT 119

  Fly   221 AISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVPISLGI----------------H 269
            .:..|||:.|..||||...::.|.....:|..|:..:|:..| ::..|                |
Mouse   120 VMGYDRYVAICHPLRYNVLMSPRGCACLVAWSWVGGSFMGTV-VTTAIFNLTFCGPNEIHHFFCH 183

  Fly   270 RPDQPLIFEDNGKKYPTCALDLTPTYAVVSSCISFYFPCVVMIGIYCRLYCYAQKHVKSIKAVTR 334
            .|  ||:....|:.    .|::.....:|  ||:....|.::|     |..|....|..:|..:.
Mouse   184 VP--PLLKLACGEN----VLEVAKGVGIV--CITALLGCFLLI-----LLSYTFIVVTILKIPSA 235

  Fly   335 PGEVAEKQRYKSIRRPKNQPKKFKVRNLHTHSSPYHVSDHKAAVTVGVIMGVFLICWVPFFCVNI 399
            .|.                                    |||..|....:.|.::.: .|..|..
Mouse   236 EGR------------------------------------HKAFSTCASHLTVVVVHY-GFASVIY 263

  Fly   400 TAAFCKTCIGGQTFKILTWLGYSNSAFNPIIYSIFNKEFRDAFKRILTMRNPWCCAQDVGNIHPR 464
            ........:||.|...:|:. ......:|||:|:.|||.:      :||:..:     :..:.|:
Mouse   264 LKPKGPKSLGGDTLMGITYT-VLTPFLSPIIFSLRNKELK------ITMKKAF-----LNKLFPQ 316

  Fly   465 NS 466
            ||
Mouse   317 NS 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dop1R1NP_001262563.1 7tm_4 134..>266 CDD:304433 42/144 (29%)
7tm_1 145..431 CDD:278431 69/314 (22%)
Olfr1564NP_001185991.1 7tm_4 44..312 CDD:304433 76/343 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.