DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dop1R1 and Olfr55

DIOPT Version :9

Sequence 1:NP_001262563.1 Gene:Dop1R1 / 41726 FlyBaseID:FBgn0011582 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_035128.2 Gene:Olfr55 / 100038859 MGIID:1333751 Length:315 Species:Mus musculus


Alignment Length:371 Identity:82/371 - (22%)
Similarity:142/371 - (38%) Gaps:100/371 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 SWTNASEMDTIVGEEPEP-LSLVSIVVVGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLA 168
            ::|..||. .::|....| |.|:..:   :||.:.:| ::.||:|:...|::|.||.....|||.
Mouse     5 NYTFVSEF-ILIGFSTFPHLQLMFFL---LFLLMYLF-TLLGNLLIMTTIWSEHSLHTPMYLFLC 64

  Fly   169 SLAIADLF---------VASLVMTFAGVNDLLGYWIFGAQFCDTWVAFDVMCSTASILNLCAISM 224
            :|:|:::|         :|.|:.|...:..|.         |.:.:.|...........|..:..
Mouse    65 ALSISEIFYTFAIIPRMLADLLTTLHSIAFLA---------CASQMFFSFTFGFTHSFLLTVMGY 120

  Fly   225 DRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSFVPISLGI----------------HRPDQ 273
            |||:.|..||||...::.|.....:|..|:..:|:..| ::..|                |.|  
Mouse   121 DRYVAICHPLRYNVLMSPRGCACLVAWSWVGGSFMGTV-VTTAIFNLTFCGPNEIHHFTCHVP-- 182

  Fly   274 PLIFEDNGKKYPTCALDLTPTYAVVSSCISFYFPCVVMIGIYCRLYCYAQKHVKSIKAVTRPGEV 338
            ||:....|:.    .|::.....:|  ||:....|.::|     |..||...|..:|..:..|. 
Mouse   183 PLLKLACGEN----VLEVAKGVEIV--CITALLGCFLLI-----LLSYAFIVVTILKIPSAEGR- 235

  Fly   339 AEKQRYKSIRRPKNQPKKFKVRNLHTHSSPYHVSDHKAAVTVGVIMGVFLICWVPFFCVNITAAF 403
                                               |||..|....:.|.::.:.....:.:....
Mouse   236 -----------------------------------HKAFSTCASHLTVVVVHYGFASVIYLKPKG 265

  Fly   404 CKTCIG----GQTFKILTWLGYSNSAFNPIIYSIFNKEFRDAFKRI 445
            .|:..|    |.|:.:||      ...:|||:|:.|||.::|.|:|
Mouse   266 PKSLEGDTLMGITYTVLT------PFLSPIIFSLRNKELKNAMKKI 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dop1R1NP_001262563.1 7tm_4 134..>266 CDD:304433 36/140 (26%)
7tm_1 145..431 CDD:278431 64/314 (20%)
Olfr55NP_035128.2 7tm_4 41..309 CDD:304433 72/330 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24247
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.