DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dop1R1 and taar12a

DIOPT Version :9

Sequence 1:NP_001262563.1 Gene:Dop1R1 / 41726 FlyBaseID:FBgn0011582 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001076578.1 Gene:taar12a / 100034659 ZFINID:ZDB-GENE-041014-99 Length:343 Species:Danio rerio


Alignment Length:346 Identity:100/346 - (28%)
Similarity:162/346 - (46%) Gaps:57/346 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 LSLVSIVVVG--IFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFA 185
            |..:::|.||  :||.::|..:|.||:::.::|...:.|:...:|.:.|||..|..:.||||.::
Zfish    35 LHRLAVVQVGLYVFLLLMILTTVFGNLMIIISISHFKHLQSPTHLIVQSLAACDCLMGSLVMPYS 99

  Fly   186 GVNDLLGYWIFGAQFCDTWVAFDVMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIA 250
            .|..:.|.|..|...|....:|||....:|:|:||.||:|||:.|.|||||...||.....:.|.
Zfish   100 MVRSVEGCWYLGDVVCKVHFSFDVTFCISSLLHLCLISVDRYLAICDPLRYKIRVTNTTMTVFII 164

  Fly   251 AIWLLAAFVSFVPISLGIHRPDQPLIFEDNGKKYPTCALDLTPTYAVVSSCISFY------FPCV 309
            .|||.:...||..:..||......::              :..||. |.||:.|:      :|.:
Zfish   165 FIWLFSVVYSFSIVFSGITAVGLEML--------------ILQTYC-VGSCVLFFNKEWAVYPFL 214

  Fly   310 -------VMIGIYCRLYCYAQKHVKSIKAVTRPGEVAEKQRYKSIRRPKNQPKKFKVRNLHTHSS 367
                   :|..:|.:::..|:||.|.:....:.|  .:.||  |.:|                  
Zfish   215 TFFITGAIMSSLYMKIFHVARKHAKVMSERVKGG--LKSQR--SAQR------------------ 257

  Fly   368 PYHVSDHKAAVTVGVIMGVFLICWVPFFCVNITAAFCKTCIGGQTFKILTWLGYSNSAFNPIIYS 432
                 :.|||.|:.::||||:.||:|:........|.......:.|.:|.|..|.||:.||:||.
Zfish   258 -----ERKAAKTLAIVMGVFMFCWLPYCAFTALYPFFTFLNSAEVFDVLFWFAYFNSSCNPLIYG 317

  Fly   433 IFNKEFRDAFKRILTMRNPWC 453
            .|...|:.|||.::.:.:..|
Zfish   318 FFYPCFQKAFKILIFLWSQKC 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dop1R1NP_001262563.1 7tm_4 134..>266 CDD:304433 48/131 (37%)
7tm_1 145..431 CDD:278431 84/298 (28%)
taar12aNP_001076578.1 7tm_4 57..328 CDD:304433 90/312 (29%)
7tm_1 59..316 CDD:278431 84/298 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.