DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dop1R1 and hrh2b

DIOPT Version :9

Sequence 1:NP_001262563.1 Gene:Dop1R1 / 41726 FlyBaseID:FBgn0011582 Length:560 Species:Drosophila melanogaster
Sequence 2:NP_001103208.1 Gene:hrh2b / 100005590 ZFINID:ZDB-GENE-070928-20 Length:335 Species:Danio rerio


Alignment Length:344 Identity:118/344 - (34%)
Similarity:176/344 - (51%) Gaps:37/344 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 IFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTFAGVNDLL-GYWIF 196
            :.|...|.|::.||||||:|:.|.|.|.::.:.|:.|||:.||.:..||:..:.:.:|. |.|..
Zfish     9 VVLVAFIALTICGNILVCMAVATSRRLHQLSSCFILSLAVTDLLLGLLVLPLSAMLELRNGKWPL 73

  Fly   197 GAQFCDTWVAFDVMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRVAVITIAAIWLLAAFVSF 261
            |..||:.:::.|||.|:||||.|.|||:|||:.|.:||.|.|.||.|...|.:.|||..:..|||
Zfish    74 GGVFCNIYISMDVMLSSASILTLLAISVDRYLAISNPLFYPRRVTPRRVAIALTAIWTCSLAVSF 138

  Fly   262 VPISLGIHRPD---QPLIFE--DNGKKYPTCALDLTPTYAVVSSCISFYFPCVVMIGIYCRLYCY 321
            |.|:||.:.||   |.|.:.  ..|::..||..:....|.::.:...||.|.:||.|:|.|::|.
Zfish   139 VSINLGWNSPDFRVQNLDWSMWGEGEEGRTCRYEWNNNYVLLKAFGIFYLPLLVMCGMYHRIFCV 203

  Fly   322 AQKHVKSIKAVTRPGEVAEKQRYKSIRRPKNQPKKFKVRNLHTHSSPYHVSDHKAAVTVGVIMGV 386
            |::.|:.|:|.|                    |...:..|     :.....:|||.||:..::|.
Zfish   204 AREQVRRIRAAT--------------------PSSAQAAN-----AAATAREHKATVTLAAVLGA 243

  Fly   387 FLICWVPFFCVNITAAFCKTCIGGQTFKILTWLGYSNSAFNPIIYSIFNKEFRDAFKRILTMRNP 451
            |:|||.|:|................|..|:.||||.|||.|||:|...|::|..|..::|     
Zfish   244 FIICWFPYFTYFTYMGMWAIHPNKLTHSIVLWLGYLNSALNPILYPALNRDFHQACGQLL----- 303

  Fly   452 WCCAQDVGNIHPRNSDRFI 470
             |.....|:.:......||
Zfish   304 -CRCGKKGDFNTSRRKTFI 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dop1R1NP_001262563.1 7tm_4 134..>266 CDD:304433 59/132 (45%)
7tm_1 145..431 CDD:278431 106/291 (36%)
hrh2bNP_001103208.1 7tm_1 21..288 CDD:278431 106/291 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.