powered by:
Protein Alignment CG3199 and KRT37
DIOPT Version :9
Sequence 1: | NP_650342.2 |
Gene: | CG3199 / 41725 |
FlyBaseID: | FBgn0038210 |
Length: | 232 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_003761.3 |
Gene: | KRT37 / 8688 |
HGNCID: | 6455 |
Length: | 449 |
Species: | Homo sapiens |
Alignment Length: | 70 |
Identity: | 18/70 - (25%) |
Similarity: | 26/70 - (37%) |
Gaps: | 0/70 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 139 MKAFSYTSTCPLEMEGKPVGALEFLCKLFIKCGDYAREGETCPNLDRNLSPRDIVFVVGKSQANT 203
|.:|..||:|||.....|.....|:..:.:.|...|........|..|::..:.|.|........
Human 1 MTSFYSTSSCPLGCTMAPGARNVFVSPIDVGCQPVAEANAASMCLLANVAHANRVRVGSTPLGRP 65
Fly 204 SCCDP 208
|.|.|
Human 66 SLCLP 70
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_28M49 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.