Sequence 1: | NP_650342.2 | Gene: | CG3199 / 41725 | FlyBaseID: | FBgn0038210 | Length: | 232 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_598491.1 | Gene: | Krt25 / 70810 | MGIID: | 1918060 | Length: | 446 | Species: | Mus musculus |
Alignment Length: | 200 | Identity: | 46/200 - (23%) |
---|---|---|---|
Similarity: | 70/200 - (35%) | Gaps: | 62/200 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 47 TRLEVKGVVLADARKLLVK----------VKFGGN-NLSLTASRTNVSEFKPNASHT-----FQA 95
Fly 96 EPPNLAQTVEENGIDFEVVYDEQVVGLGKLSLPKRL--------STRIKL-DMKAFSYTSTCPLE 151
Fly 152 MEGKPVGALEFLCKLFIKCGDYAREGETCPNLDRNLSPRDIVFVVGKSQANTSCCDPCRDALEIE 216
Fly 217 ARKQK 221 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3199 | NP_650342.2 | DUF4788 | 45..>216 | CDD:292651 | 43/193 (22%) |
Krt25 | NP_598491.1 | Head. /evidence=ECO:0000255 | 1..74 | ||
Filament | 74..387 | CDD:278467 | 45/199 (23%) | ||
Coil 1A. /evidence=ECO:0000255 | 75..110 | ||||
Linker 1. /evidence=ECO:0000255 | 111..132 | ||||
Coil 1B. /evidence=ECO:0000255 | 133..224 | 6/26 (23%) | |||
Linker 12. /evidence=ECO:0000255 | 225..247 | 7/29 (24%) | |||
Coil 2. /evidence=ECO:0000255 | 248..386 | 32/140 (23%) | |||
YlqD | 334..>377 | CDD:287979 | 6/38 (16%) | ||
Tail. /evidence=ECO:0000255 | 387..446 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_28M49 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |