DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3199 and Krt25

DIOPT Version :9

Sequence 1:NP_650342.2 Gene:CG3199 / 41725 FlyBaseID:FBgn0038210 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_598491.1 Gene:Krt25 / 70810 MGIID:1918060 Length:446 Species:Mus musculus


Alignment Length:200 Identity:46/200 - (23%)
Similarity:70/200 - (35%) Gaps:62/200 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 TRLEVKGVVLADARKLLVK----------VKFGGN-NLSLTASRTNVSEFKPNASHT-----FQA 95
            |.||::...|::....|.|          ...||| |:.:.|:        |....|     .:|
Mouse   197 TDLEIQYETLSEELTYLKKNHKEEMQALQCAAGGNVNVEMNAA--------PGVDLTVLLNNMRA 253

  Fly    96 EPPNLAQTVEENGIDFEVVYDEQVVGLGKLSLPKRL--------STRIKL-DMKAFSYTSTCPLE 151
            |...||   |:|..|.|..:.|:     ..||.:::        |.|.:| :||....|    ||
Mouse   254 EYEALA---EQNRRDAEAWFQEK-----SASLQQQITEDVGATTSARNELTEMKRTLQT----LE 306

  Fly   152 MEGKPVGALEFLCKLFIKCGDYAREGETCPNLDRNLSPRDIVFVVGKSQANTSCCDPCRDALEIE 216
            :|.:.:.|    .|..::|.....||..|..|             .:.||..|..:.....:..|
Mouse   307 IELQSLLA----TKHSLECSLTETEGNYCTQL-------------AQIQAQISALEEQLHQVRTE 354

  Fly   217 ARKQK 221
            ...||
Mouse   355 TEGQK 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3199NP_650342.2 DUF4788 45..>216 CDD:292651 43/193 (22%)
Krt25NP_598491.1 Head. /evidence=ECO:0000255 1..74
Filament 74..387 CDD:278467 45/199 (23%)
Coil 1A. /evidence=ECO:0000255 75..110
Linker 1. /evidence=ECO:0000255 111..132
Coil 1B. /evidence=ECO:0000255 133..224 6/26 (23%)
Linker 12. /evidence=ECO:0000255 225..247 7/29 (24%)
Coil 2. /evidence=ECO:0000255 248..386 32/140 (23%)
YlqD 334..>377 CDD:287979 6/38 (16%)
Tail. /evidence=ECO:0000255 387..446
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M49
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.