DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3199 and Krt42

DIOPT Version :9

Sequence 1:NP_650342.2 Gene:CG3199 / 41725 FlyBaseID:FBgn0038210 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_997648.2 Gene:Krt42 / 68239 MGIID:1915489 Length:452 Species:Mus musculus


Alignment Length:169 Identity:31/169 - (18%)
Similarity:68/169 - (40%) Gaps:40/169 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 NNLSLTASRTNVSEFK---PNASHTFQAEPPNLAQTVEENGIDFEVVYDEQVVGL-GKLSLPKRL 131
            |..:|.:|||.::|.:   .|.....|:: .::..::|.:..:.|..|..|:..| |.:|..::.
Mouse   299 NTEALQSSRTEITELRRSVQNLEIELQSQ-LSMKASLENSLAETEARYGAQLAQLQGLISSVEQQ 362

  Fly   132 STRIKLDMKAFSYTSTCPLEMEGKPVGALEFLCKLFIKCGDYAR--EGETC-------------P 181
            ...::.||:..::.....|:::          .:|..:...|.|  |||..             |
Mouse   363 LCELRCDMERQNHEYQVLLDVK----------TRLEQEIATYRRLLEGEDAHLATQYSSSLASQP 417

  Fly   182 NLDRNLSPRDIVFVVGKSQANTSCCDPCRDALEIEARKQ 220
            :.:..::.|.:..:|.:.|          |...:.:|:|
Mouse   418 SREGMVTSRQVRTIVEEVQ----------DGKVVSSREQ 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3199NP_650342.2 DUF4788 45..>216 CDD:292651 29/163 (18%)
Krt42NP_997648.2 Head. /evidence=ECO:0000255 4..93
Filament 93..404 CDD:278467 24/115 (21%)
Coil 1A. /evidence=ECO:0000255 94..129
Linker 1. /evidence=ECO:0000255 130..147
Coil 1B. /evidence=ECO:0000255 148..239
FliD_C <236..358 CDD:284583 14/59 (24%)
Linker 12. /evidence=ECO:0000255 240..262
Coil 2. /evidence=ECO:0000255 263..401 22/112 (20%)
Tail. /evidence=ECO:0000255 402..452 7/55 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M49
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.