powered by:
Protein Alignment CG3199 and Krt20
DIOPT Version :9
Sequence 1: | NP_650342.2 |
Gene: | CG3199 / 41725 |
FlyBaseID: | FBgn0038210 |
Length: | 232 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_075745.1 |
Gene: | Krt20 / 66809 |
MGIID: | 1914059 |
Length: | 431 |
Species: | Mus musculus |
Alignment Length: | 71 |
Identity: | 19/71 - (26%) |
Similarity: | 30/71 - (42%) |
Gaps: | 15/71 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 47 TRLEVKGVVLADARKLLVKVKFGGNNLSLTASRTNVSEFKPNASHTFQAEPPNLAQTVEENGIDF 111
||||.: :|..|:|| .|.::..|..:.:..|.| ..:.....:||.|..:|.
Mouse 368 TRLEQE---IATYRRLL-----EGEDIKTTEYQLSTLEMK-------DIKKTRKIKTVVEEVVDG 417
Fly 112 EVVYDE 117
:||..|
Mouse 418 KVVSSE 423
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_28M49 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.