DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG3199 and Krt20

DIOPT Version :9

Sequence 1:	NP_650342.2	Gene:	CG3199 / 41725	FlyBaseID:	FBgn0038210	Length:	232	Species:	Drosophila melanogaster
Sequence 2:	NP_075745.1	Gene:	Krt20 / 66809	MGIID:	1914059	Length:	431	Species:	Mus musculus

Alignment Length:	71	Identity:	19/71 - (26%)
Similarity:	30/71 - (42%)	Gaps:	15/71 - (21%)

- Green bases have known domain annotations that are detailed below.

  Fly    47 TRLEVKGVVLADARKLLVKVKFGGNNLSLTASRTNVSEFKPNASHTFQAEPPNLAQTVEENGIDF 111
            ||||.:   :|..|:||     .|.::..|..:.:..|.|       ..:.....:||.|..:|.
Mouse   368 TRLEQE---IATYRRLL-----EGEDIKTTEYQLSTLEMK-------DIKKTRKIKTVVEEVVDG 417

  Fly   112 EVVYDE 117
            :||..|
Mouse   418 KVVSSE 423

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG3199	NP_650342.2	DUF4788	45..>216	CDD:292651	19/71 (27%)
Krt20	NP_075745.1	Head. /evidence=ECO:0000255	1..76
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..23
		Filament	76..385	CDD:278467	9/24 (38%)
		Coil 1A. /evidence=ECO:0000255	77..112
		Linker 1. /evidence=ECO:0000255	113..130
		Coil 1B. /evidence=ECO:0000255	131..222
		Linker 12. /evidence=ECO:0000255	223..245
		Coil 2. /evidence=ECO:0000255	246..384		8/23 (35%)
		Tail. /evidence=ECO:0000255	385..431		10/46 (22%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_28M49
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900