DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3199 and KRT20

DIOPT Version :9

Sequence 1:NP_650342.2 Gene:CG3199 / 41725 FlyBaseID:FBgn0038210 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_061883.1 Gene:KRT20 / 54474 HGNCID:20412 Length:424 Species:Homo sapiens


Alignment Length:181 Identity:43/181 - (23%)
Similarity:56/181 - (30%) Gaps:68/181 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 FDRNLPVFSFDLVITRLEVKG--VVLADARKLLVKVKFGGNNLSLTASRTNVSEFKPNASHTFQA 95
            |:|...|....:.:...|:||  |.|.:.|                  ||:.|......||....
Human   261 FERQTAVLQQQVTVNTEELKGTEVQLTELR------------------RTSQSLEIELQSHLSMK 307

  Fly    96 EPPNLAQTVEENGIDFEVVYDEQVVGLGKL--SLPKRL------------STRIKLDMKAFSYTS 146
            |  :|..|:||.    :..|..|:..|..|  ||..:|            ...|.||:|.     
Human   308 E--SLEHTLEET----KARYSSQLANLQSLLSSLEAQLMQIRSNMERQNNEYHILLDIKT----- 361

  Fly   147 TCPLEMEGKPVGALEFLCKLFIKCGDYAR--EGETCPNLDRNLS---PRDI 192
              .||.|                ...|.|  |||.....:..||   .|||
Human   362 --RLEQE----------------IATYRRLLEGEDVKTTEYQLSTLEERDI 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3199NP_650342.2 DUF4788 45..>216 CDD:292651 40/169 (24%)
KRT20NP_061883.1 Head 1..69
Filament 69..380 CDD:306535 38/165 (23%)
Coil 1A 70..105
Linker 1 106..123
Coil 1B 124..215
Linker 12 216..238
Coil 2 239..377 36/162 (22%)
Tail 378..424 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M49
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.