DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3199 and Krt35

DIOPT Version :9

Sequence 1:NP_650342.2 Gene:CG3199 / 41725 FlyBaseID:FBgn0038210 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_058576.2 Gene:Krt35 / 53617 MGIID:1858899 Length:455 Species:Mus musculus


Alignment Length:171 Identity:36/171 - (21%)
Similarity:50/171 - (29%) Gaps:71/171 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 VEENGIDFEVVYDEQVVGLG---------------------------KLSLPKRLSTRIKLDMKA 141
            ||.|..|.|..||.|...|.                           ::.|..:.|.|..||   
Mouse   277 VENNRRDAEDWYDTQTEELNQQVVSSSEQLQSCQSDIIELRRTVNSLEIELQAQQSMRDALD--- 338

  Fly   142 FSYTSTCPLEMEGKPVGAL-EFLCKLFIKCGDYARE-GETCPNLDRNLSPRDIVFVVGKSQANTS 204
                ||. .|.||:....| :..|.:    |:...: ||...:|:|......::..|   :|...
Mouse   339 ----STL-AETEGRYSSQLAQMQCMI----GNVESQLGEIRADLERQNQEYQVLLDV---RARLE 391

  Fly   205 C-----------------CDPCRDALEIEARKQKDYSIQSS 228
            |                 |:||          ..|||...|
Mouse   392 CEINTYRGLLESEDSKLPCNPC----------APDYSSSKS 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3199NP_650342.2 DUF4788 45..>216 CDD:292651 32/157 (20%)
Krt35NP_058576.2 Head. /evidence=ECO:0000255 1..97
Filament 96..407 CDD:278467 29/144 (20%)
Coil 1A. /evidence=ECO:0000255 98..132
Linker 1. /evidence=ECO:0000255 133..143
Coil 1B. /evidence=ECO:0000255 144..244
MIT_CorA-like <192..>334 CDD:294313 11/56 (20%)
Linker 12. /evidence=ECO:0000255 245..260
Coil 2. /evidence=ECO:0000255 261..404 29/141 (21%)
DUF5082 305..408 CDD:293493 20/117 (17%)
Tail. /evidence=ECO:0000255 405..455 7/28 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M49
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.