DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG3199 and Krt42

DIOPT Version :9

Sequence 1:	NP_650342.2	Gene:	CG3199 / 41725	FlyBaseID:	FBgn0038210	Length:	232	Species:	Drosophila melanogaster
Sequence 2:	NP_001008816.1	Gene:	Krt42 / 450231	RGDID:	1359182	Length:	452	Species:	Rattus norvegicus

Alignment Length:	74	Identity:	17/74 - (22%)
Similarity:	37/74 - (50%)	Gaps:	5/74 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly    71 NNLSLTASRTNVSEFK---PNASHTFQAEPPNLAQTVEENGIDFEVVYDEQVVGL-GKLSLPKRL 131
            |..:|.:|||.::|.:   .|.....|:: .::..::|.:..:.|..|..|:..| |.:|..::.
  Rat   299 NTEALQSSRTEITELRRSVQNLEIELQSQ-LSMKASLENSLAETEARYGAQLAQLQGLISSMEQQ 362

  Fly   132 STRIKLDMK 140
            ...::.||:
  Rat   363 LCELRCDME 371

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG3199	NP_650342.2	DUF4788	45..>216	CDD:292651	17/74 (23%)
Krt42	NP_001008816.1	Head. /evidence=ECO:0000255	4..93
		Filament	93..404	CDD:278467	17/74 (23%)
		Coil 1A. /evidence=ECO:0000255	94..129
		Linker 1. /evidence=ECO:0000255	130..147
		Coil 1B. /evidence=ECO:0000255	148..239
		FliD_C	192..361	CDD:284583	15/62 (24%)
		Linker 12. /evidence=ECO:0000255	240..262
		Coil 2. /evidence=ECO:0000255	263..401		17/74 (23%)
		Tail. /evidence=ECO:0000255	402..452
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_28M49
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900