DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3199 and Krt42

DIOPT Version :10

Sequence 1:NP_650342.2 Gene:CG3199 / 41725 FlyBaseID:FBgn0038210 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001008816.1 Gene:Krt42 / 450231 RGDID:1359182 Length:452 Species:Rattus norvegicus


Alignment Length:74 Identity:17/74 - (22%)
Similarity:37/74 - (50%) Gaps:5/74 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 NNLSLTASRTNVSEFK---PNASHTFQAEPPNLAQTVEENGIDFEVVYDEQVVGL-GKLSLPKRL 131
            |..:|.:|||.::|.:   .|.....|:: .::..::|.:..:.|..|..|:..| |.:|..::.
  Rat   299 NTEALQSSRTEITELRRSVQNLEIELQSQ-LSMKASLENSLAETEARYGAQLAQLQGLISSMEQQ 362

  Fly   132 STRIKLDMK 140
            ...::.||:
  Rat   363 LCELRCDME 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3199NP_650342.2 DUF4788 45..>216 CDD:406440 17/74 (23%)
Krt42NP_001008816.1 Head. /evidence=ECO:0000255 4..93
Filament 93..404 CDD:459643 17/74 (23%)
Coil 1A. /evidence=ECO:0000255 94..129
Linker 1. /evidence=ECO:0000255 130..147
Coil 1B. /evidence=ECO:0000255 148..239
Linker 12. /evidence=ECO:0000255 240..262
Coil 2. /evidence=ECO:0000255 263..401 17/74 (23%)
Tail. /evidence=ECO:0000255 402..452
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.