DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3199 and Krt27

DIOPT Version :10

Sequence 1:NP_650342.2 Gene:CG3199 / 41725 FlyBaseID:FBgn0038210 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001008824.1 Gene:Krt27 / 450229 RGDID:1359115 Length:449 Species:Rattus norvegicus


Alignment Length:200 Identity:47/200 - (23%)
Similarity:71/200 - (35%) Gaps:62/200 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 TRLEVKGVVLADARKLLVK----------VKFGGN-NLSLTASRTNVSEFKPNASHT-----FQA 95
            |.|||:...|::....|.|          ...||| |:.:.|:        |....|     .:|
  Rat   196 TDLEVQLETLSEELAYLKKNHEEEMQALQCAAGGNVNVEMNAA--------PGVDLTVLLNNMRA 252

  Fly    96 EPPNLAQTVEENGIDFEVVYDEQVVGLGKLSLPKRL--------STRIKL-DMKAFSYTSTCPLE 151
            |...||   |:|..|.|..:.|:     ..||.:::        |.|.:| :||....|    ||
  Rat   253 EYEALA---EQNRRDAEAWFQEK-----SASLQQQISDDAGATTSARNELTEMKRTLQT----LE 305

  Fly   152 MEGKPVGALEFLCKLFIKCGDYAREGETCPNLDRNLSPRDIVFVVGKSQANTSCCDPCRDALEIE 216
            :|.:.:.|:    |..::|.....||..|..|             .:.||..|..:.....:..|
  Rat   306 IELQSLLAM----KHSLECSLTETEGNYCTQL-------------AQIQAQISALEEQLHQVRTE 353

  Fly   217 ARKQK 221
            ...||
  Rat   354 TEGQK 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3199NP_650342.2 DUF4788 45..>216 CDD:406440 44/193 (23%)
Krt27NP_001008824.1 Head. /evidence=ECO:0000255 1..73
Filament 73..386 CDD:459643 46/199 (23%)
Coil 1A. /evidence=ECO:0000255 74..109
Linker 1. /evidence=ECO:0000255 110..131
Coil 1B. /evidence=ECO:0000255 132..223 7/26 (27%)
Linker 12. /evidence=ECO:0000255 224..246 7/29 (24%)
Coil 2. /evidence=ECO:0000255 247..385 32/140 (23%)
Tail. /evidence=ECO:0000255 386..449
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 425..449
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.