DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3199 and krt97

DIOPT Version :9

Sequence 1:NP_650342.2 Gene:CG3199 / 41725 FlyBaseID:FBgn0038210 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001002383.1 Gene:krt97 / 436656 ZFINID:ZDB-GENE-040718-78 Length:438 Species:Danio rerio


Alignment Length:109 Identity:26/109 - (23%)
Similarity:47/109 - (43%) Gaps:31/109 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 DLVITR----LEVKGVVLADARKLLVKVK------FGGNNLSLTASRTNVSEFKPNASHTFQAEP 97
            ||.:||    ::::|:     ::.||.:|      .......:|:|..||.         ..|.|
Zfish   190 DLTMTRSDLEMQIEGL-----KEELVYLKKNHAEELAALRAQMTSSSVNVE---------VDAAP 240

  Fly    98 -PNLAQTVEENGIDFEVVYDEQVVGL-----GKL-SLPKRLSTR 134
             .:||:.:||....:|.:.::....:     ||. .|.|::|||
Zfish   241 QQDLARIMEEMRQQYEGITEKNKREMEAWYKGKFDELNKQVSTR 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3199NP_650342.2 DUF4788 45..>216 CDD:292651 24/107 (22%)
krt97NP_001002383.1 Filament 78..387 CDD:278467 26/109 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M49
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.