DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3199 and Ppi1

DIOPT Version :9

Sequence 1:NP_650342.2 Gene:CG3199 / 41725 FlyBaseID:FBgn0038210 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_733345.2 Gene:Ppi1 / 43581 FlyBaseID:FBgn0051025 Length:998 Species:Drosophila melanogaster


Alignment Length:261 Identity:62/261 - (23%)
Similarity:100/261 - (38%) Gaps:36/261 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KKG--KDKGKKGKKSVFRAKSTVVPTAPPEPVFDRNLPV--------------FSFDLVITRLEV 51
            :||  ::|.||||.:   ...:..|....|.|:....|.              |:..|::.:|.:
  Fly    53 EKGNAQEKDKKGKGA---CCCSSCPVRNREEVYQPRCPAPGQKGKPNRDYMRCFAAKLIVQKLNM 114

  Fly    52 KGVVLADARKLLVKVKF-GGNNLSLTASRTNVSEFKPNASHTFQAEPPNLAQTVEENGIDFEVVY 115
            .|.......||.:|... .|..:.|.:|..||:....|...|||.|...|.:.:.| ||:..|||
  Fly   115 PGRDFECQDKLQIKANVCRGCKICLGSSSINVNCLPLNPDKTFQMEAECLQRQLAE-GINISVVY 178

  Fly   116 DEQVVGLGKLSLPKRLSTRIKLDMKAFSYTSTCPLEMEGKPVGALEFLCKLFIKC---GDYAREG 177
            ..:.:..|....|..:.:|:..|.....:.:...|..:|..||.:.....:.::|   .:.|.:|
  Fly   179 LRKEIARGCYFPPAAVVSRMINDFDEIVHDANVELTCKGCTVGIMNIRFAMQMRCQTLKEDAVDG 243

  Fly   178 ETCPNLDRNLSPRDIVFVVGKSQANTSCCDPCRDAL----EI--------EARKQKDYSIQSSSS 230
            ......:|...|...|.:...|..:||..|||...:    |:        |.|.|..:..|.|..
  Fly   244 RLAGGQERGCFPNMNVDLQDLSFMSTSSIDPCVGFMPSDTEVAQDSPPCSEDRAQDSFQCQDSPP 308

  Fly   231 R 231
            |
  Fly   309 R 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3199NP_650342.2 DUF4788 45..>216 CDD:292651 43/186 (23%)
Ppi1NP_733345.2 DUF4788 108..>294 CDD:292651 43/186 (23%)
DUF4776 371..848 CDD:292622
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M49
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008544
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.