DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3199 and CG14355

DIOPT Version :9

Sequence 1:NP_650342.2 Gene:CG3199 / 41725 FlyBaseID:FBgn0038210 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_650340.1 Gene:CG14355 / 41723 FlyBaseID:FBgn0038208 Length:1024 Species:Drosophila melanogaster


Alignment Length:208 Identity:81/208 - (38%)
Similarity:117/208 - (56%) Gaps:4/208 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KKSVFRAKSTVVP--TAPPEPVFDRN--LPVFSFDLVITRLEVKGVVLADARKLLVKVKFGGNNL 73
            ||||..|.:...|  ..|||.|..:.  :|||.||:::|.||.|.....:..||.|...|....|
  Fly     5 KKSVAVAIAETKPEDQPPPEKVKPKKEPIPVFVFDVIVTHLEAKNTEFTNPSKLEVTANFFKTPL 69

  Fly    74 SLTASRTNVSEFKPNASHTFQAEPPNLAQTVEENGIDFEVVYDEQVVGLGKLSLPKRLSTRIKLD 138
            .||.|:.|||:||.||..:.|.:|..:.:||.:.||.|.|||.::|:|.|:.|.|..:...|:.|
  Fly    70 LLTNSQINVSDFKANAGLSLQKDPKEIRKTVNDCGISFSVVYSKKVIGSGQASFPSSVVDSIEKD 134

  Fly   139 MKAFSYTSTCPLEMEGKPVGALEFLCKLFIKCGDYAREGETCPNLDRNLSPRDIVFVVGKSQANT 203
            |....::....|...|:..|.|||||:|.:.|.....|.|...|:||:::.:||:||:|:||...
  Fly   135 MTDILHSDVIDLAAGGEVTGKLEFLCRLVVMCIADEPELECARNMDRSINAQDIMFVMGESQVCP 199

  Fly   204 SCCDPCRDALEIE 216
            |.|:||::.||.|
  Fly   200 SACEPCQNDLEAE 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3199NP_650342.2 DUF4788 45..>216 CDD:292651 65/170 (38%)
CG14355NP_650340.1 DUF4788 41..265 CDD:292651 66/172 (38%)
DUF4776 345..788 CDD:292622
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466846
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M49
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008544
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.