DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3199 and KRT34

DIOPT Version :9

Sequence 1:NP_650342.2 Gene:CG3199 / 41725 FlyBaseID:FBgn0038210 Length:232 Species:Drosophila melanogaster
Sequence 2:XP_011523095.1 Gene:KRT34 / 3885 HGNCID:6452 Length:412 Species:Homo sapiens


Alignment Length:195 Identity:41/195 - (21%)
Similarity:64/195 - (32%) Gaps:36/195 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PTAPPEPVFDRNLPVFSFDLVITRLEVKGVVLADARKLLVKVKFGGNNLS------LTASRT-NV 82
            ||.....|.:.....:...:.|.|.||:........:|..:|......|.      :...|| |.
Human   235 PTVDLNQVLNETRSQYEALVEINRREVEQWFATQTEELNKQVVSSSEQLQSCQAEIIELRRTVNA 299

  Fly    83 SEFKPNASHTFQAEPPNLAQTVEENGIDFEVVYDEQVVGLGKLSLPKRLSTRIKLDMKAFSYTST 147
            .|.:..|.|       ||..::|....:.|..|..|      ||..:.|.|.::..:...    .
Human   300 LEIELQAQH-------NLRDSLENTLTESEAHYSSQ------LSQVQSLITNVESQLAEI----R 347

  Fly   148 CPLEMEGKPVGA-LEFLCKLFIKCGDYAR--EGETCPNLDRNLSPRDIVFVVGKSQANTSCCDPC 209
            |.||.:.:.... |:...:|..:...|..  |.|.| .|..|        ....:.|:.:.|.||
Human   348 CDLERQNQEYQVLLDVRARLECEINTYRSLLESEDC-KLPCN--------PCATTNASGNSCGPC 403

  Fly   210  209
            Human   404  403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3199NP_650342.2 DUF4788 45..>216 CDD:292651 38/175 (22%)
KRT34XP_011523095.1 Filament 73..384 CDD:278467 35/166 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M49
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.