Sequence 1: | NP_650342.2 | Gene: | CG3199 / 41725 | FlyBaseID: | FBgn0038210 | Length: | 232 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011523095.1 | Gene: | KRT34 / 3885 | HGNCID: | 6452 | Length: | 412 | Species: | Homo sapiens |
Alignment Length: | 195 | Identity: | 41/195 - (21%) |
---|---|---|---|
Similarity: | 64/195 - (32%) | Gaps: | 36/195 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 25 PTAPPEPVFDRNLPVFSFDLVITRLEVKGVVLADARKLLVKVKFGGNNLS------LTASRT-NV 82
Fly 83 SEFKPNASHTFQAEPPNLAQTVEENGIDFEVVYDEQVVGLGKLSLPKRLSTRIKLDMKAFSYTST 147
Fly 148 CPLEMEGKPVGA-LEFLCKLFIKCGDYAR--EGETCPNLDRNLSPRDIVFVVGKSQANTSCCDPC 209
Fly 210 209 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3199 | NP_650342.2 | DUF4788 | 45..>216 | CDD:292651 | 38/175 (22%) |
KRT34 | XP_011523095.1 | Filament | 73..384 | CDD:278467 | 35/166 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_28M49 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |