DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG3199 and KRT17

DIOPT Version :9

Sequence 1:	NP_650342.2	Gene:	CG3199 / 41725	FlyBaseID:	FBgn0038210	Length:	232	Species:	Drosophila melanogaster
Sequence 2:	NP_000413.1	Gene:	KRT17 / 3872	HGNCID:	6427	Length:	432	Species:	Homo sapiens

Alignment Length:	122	Identity:	34/122 - (27%)
Similarity:	44/122 - (36%)	Gaps:	26/122 - (21%)

- Green bases have known domain annotations that are detailed below.

  Fly   121 GLGKLSLPKRLSTRIKLDMKAFSYTSTCPLEME---GKPVGALEF-LCKLFIKCGDYAR------ 175
            |||..|  .|.|.|:...:.|    .:|.|...   |..:|...: .|..|...|.|..
Human    19 GLGGGS--SRTSCRLSGGLGA----GSCRLGSAGGLGSTLGGSSYSSCYSFGSGGGYGSSFGGVD 77

  Fly   176 ------EGETCPNL-DRNLSPRDIVFVVGKSQANTSCCDPCRDALEIEA-RKQKDYS 224
                  |..|..|| ||..|..|.|..:  .:|||......||..:.:| ...:|||
Human    78 GLLAGGEKATMQNLNDRLASYLDKVRAL--EEANTELEVKIRDWYQRQAPGPARDYS 132

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG3199	NP_650342.2	DUF4788	45..>216	CDD:292651	30/111 (27%)
KRT17	NP_000413.1	Head	1..83		16/69 (23%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..24		3/4 (75%)
		Filament	84..394	CDD:365827	18/51 (35%)
		Coil 1A	84..120		14/37 (38%)
		Peptide epitope S1, induces T-cell and keratinocyte proliferation and IFN-gamma production	102..116		4/15 (27%)
		Linker 1	121..138		4/12 (33%)
		Coil 1B	139..230
		Peptide epitope S2, induces T-cell proliferation and IFN-gamma production	153..167
		Linker 12	231..250
		Coil 2	251..392
		Peptide epitope S4, induces T-cell and keratinocyte proliferation and IFN-gamma production	332..346
		Tail	393..432
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_28M49
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900