DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3199 and KRT10

DIOPT Version :9

Sequence 1:NP_650342.2 Gene:CG3199 / 41725 FlyBaseID:FBgn0038210 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001366295.1 Gene:KRT10 / 3858 HGNCID:6413 Length:624 Species:Homo sapiens


Alignment Length:132 Identity:28/132 - (21%)
Similarity:51/132 - (38%) Gaps:24/132 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 KLLVKVKFGGNNLSLTAS-RTNVSEFKPNASHTFQAEPPNLAQTVEENGIDFEVVYDEQVVGLGK 124
            |.|..|..|..|:.:.|: ..::::...|....::       |..|:|..|.|..::|:      
Human   292 KDLRNVSTGDVNVEMNAAPGVDLTQLLNNMRSQYE-------QLAEQNRKDAEAWFNEK------ 343

  Fly   125 LSLPKRLSTRIKLDMKAFSYTSTCPLEMEGKPVGALE------FLCKLFIKCGDYAREGETCPNL 183
               .|.|:|.|..:::..|...:...|:. :.|.|||      ...|..::......||..|..|
Human   344 ---SKELTTEIDNNIEQISSYKSEITELR-RNVQALEIELQSQLALKQSLEASLAETEGRYCVQL 404

  Fly   184 DR 185
            .:
Human   405 SQ 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3199NP_650342.2 DUF4788 45..>216 CDD:292651 28/132 (21%)
KRT10NP_001366295.1 Head 1..145
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Filament 145..454 CDD:365827 28/132 (21%)
Coil 1A 146..181
Linker 1 182..202
Coil 1B 203..294 1/1 (100%)
Linker 12 295..317 4/21 (19%)
Coil 2 318..456 22/106 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M49
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.