DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3199 and KRT27

DIOPT Version :10

Sequence 1:NP_650342.2 Gene:CG3199 / 41725 FlyBaseID:FBgn0038210 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_853515.2 Gene:KRT27 / 342574 HGNCID:30841 Length:459 Species:Homo sapiens


Alignment Length:41 Identity:9/41 - (21%)
Similarity:21/41 - (51%) Gaps:0/41 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 RLIETVEETGDEFFLKAWPKTFNMAPSESDYENQSHNSEEG 93
            :|:|...:..::.|.:|.|.|..:...:.|::.::|....|
Human  1155 QLVEKEVKLREKQFSQARPLTRYLPNRKEDFDLKTHIESSG 1195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3199NP_650342.2 DUF4788 45..>216 CDD:406440 9/41 (22%)
KRT27NP_853515.2 Head. /evidence=ECO:0000255 1..83
Filament 83..396 CDD:459643
Coil 1A. /evidence=ECO:0000255 84..119
Linker 1. /evidence=ECO:0000255 120..141
Coil 1B. /evidence=ECO:0000255 142..233
Linker 12. /evidence=ECO:0000255 234..256
Coil 2. /evidence=ECO:0000255 257..395
Tail. /evidence=ECO:0000255 396..459
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 436..459
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.