DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3199 and CG31327

DIOPT Version :9

Sequence 1:NP_650342.2 Gene:CG3199 / 41725 FlyBaseID:FBgn0038210 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_731888.1 Gene:CG31327 / 318684 FlyBaseID:FBgn0051327 Length:861 Species:Drosophila melanogaster


Alignment Length:219 Identity:55/219 - (25%)
Similarity:84/219 - (38%) Gaps:29/219 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 FSFDLVITRLEVKGVVLADARKLLVKVKFGGNNLSLTASRTNVSEFKPNASHTFQAEPPNLAQTV 104
            |.||:|:|.|::...| .:...|...|||||.|:::|:||.||.:|..|....|...|..|..::
  Fly    12 FLFDIVVTSLDLDKPV-KEPELLQALVKFGGVNINITSSRINVQDFVNNRVTQFTTSPSALRHSL 75

  Fly   105 EENGIDFEVVYDEQVVGLGKLSLPKRLSTRIKLDMKAFSYTSTCPLEMEGKPVGALEFLCKLFIK 169
            |:.|:.....|....:|...|..|.....:|...|....|..|..|......:|.:.....|.||
  Fly    76 EDQGMQISARYAGSSLGSNVLLFPDTFIDKISPKMNDLFYEETINLMRRADCIGTITIRLVLIIK 140

  Fly   170 CGD------------------------YAREG---ETCPNLDRNLSPRDIVFVVGKSQANTSC-C 206
            |.|                        ..::|   |.|..|....:.:|::||:|........ .
  Fly   141 CIDTEIIKEPRRSSSPRMSRKSIAEDILPKKGLQKENCQGLGPTFNAQDVMFVIGDPDPLLKIPS 205

  Fly   207 DPCRDALEIEARKQKDYSIQSSSS 230
            :||.:....|...:.|..:|...|
  Fly   206 EPCSELRFEEGDVRLDLDLQRYKS 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3199NP_650342.2 DUF4788 45..>216 CDD:292651 48/198 (24%)
CG31327NP_731888.1 DUF4788 17..267 CDD:292651 52/214 (24%)
DUF4776 315..775 CDD:292622
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M49
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008544
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.