DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3199 and Krt14

DIOPT Version :9

Sequence 1:NP_650342.2 Gene:CG3199 / 41725 FlyBaseID:FBgn0038210 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001008751.1 Gene:Krt14 / 287701 RGDID:1307463 Length:485 Species:Rattus norvegicus


Alignment Length:77 Identity:19/77 - (24%)
Similarity:37/77 - (48%) Gaps:14/77 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 VITRLEVKGVVLADARKLLVKVKFGGNNLSLTASR-TNVSEFKPNASHTFQAEPPNLAQTVEENG 108
            |.||||.:   :|..|:||     .|.:..|:::: ::.|:|...:..:......|  :.:....
  Rat   411 VKTRLEQE---IATYRRLL-----EGEDAHLSSAQFSSSSQFSSGSQSSRDVTSTN--RQIRTKV 465

  Fly   109 IDFEVVYDEQVV 120
            :|   |:|.:||
  Rat   466 MD---VHDGKVV 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3199NP_650342.2 DUF4788 45..>216 CDD:292651 19/77 (25%)
Krt14NP_001008751.1 Head. /evidence=ECO:0000250|UniProtKB:P02533 1..121
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
Filament 121..432 CDD:278467 10/28 (36%)
Coil 1A. /evidence=ECO:0000250|UniProtKB:P02533 122..157
Linker 1. /evidence=ECO:0000250|UniProtKB:P02533 158..175
Coil 1B. /evidence=ECO:0000250|UniProtKB:P02533 176..267
Linker 12. /evidence=ECO:0000250|UniProtKB:P02533 268..290
Coil 2. /evidence=ECO:0000250|UniProtKB:P02533 291..429 9/25 (36%)
Tail. /evidence=ECO:0000250|UniProtKB:P02533 430..485 9/50 (18%)
Interaction with Type I keratins and keratin filaments. /evidence=ECO:0000250 432..485 9/48 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 437..458 2/20 (10%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M49
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.