powered by:
Protein Alignment CG3199 and Krt9
DIOPT Version :9
Sequence 1: | NP_650342.2 |
Gene: | CG3199 / 41725 |
FlyBaseID: | FBgn0038210 |
Length: | 232 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_703206.2 |
Gene: | Krt9 / 266717 |
RGDID: | 628785 |
Length: | 662 |
Species: | Rattus norvegicus |
Alignment Length: | 65 |
Identity: | 12/65 - (18%) |
Similarity: | 31/65 - (47%) |
Gaps: | 10/65 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 78 SRTNVSEFKPNASHTFQAEPPNLAQTVEENGIDFEVVYDEQVVGLG--KLSLPKRLSTRIKLDMK 140
||.....|:.:.||.: |..:.:::..:|.....::.::.:. :::|. ..|:||:|:
Rat 176 SRKGNRVFQKDYSHYY-----NTIEDLKDRIVDLTARNNKALIDMDNTRMTLG---DFRVKLEME 232
Fly 141 140
Rat 233 232
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_28M49 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.