DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3199 and Krt9

DIOPT Version :9

Sequence 1:NP_650342.2 Gene:CG3199 / 41725 FlyBaseID:FBgn0038210 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_703206.2 Gene:Krt9 / 266717 RGDID:628785 Length:662 Species:Rattus norvegicus


Alignment Length:65 Identity:12/65 - (18%)
Similarity:31/65 - (47%) Gaps:10/65 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 SRTNVSEFKPNASHTFQAEPPNLAQTVEENGIDFEVVYDEQVVGLG--KLSLPKRLSTRIKLDMK 140
            ||.....|:.:.||.:     |..:.:::..:|.....::.::.:.  :::|.   ..|:||:|:
  Rat   176 SRKGNRVFQKDYSHYY-----NTIEDLKDRIVDLTARNNKALIDMDNTRMTLG---DFRVKLEME 232

  Fly   141  140
              Rat   233  232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3199NP_650342.2 DUF4788 45..>216 CDD:292651 12/65 (18%)
Krt9NP_703206.2 Filament 138..450 CDD:365827 12/65 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M49
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.