DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3199 and KRT24

DIOPT Version :10

Sequence 1:NP_650342.2 Gene:CG3199 / 41725 FlyBaseID:FBgn0038210 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_061889.2 Gene:KRT24 / 192666 HGNCID:18527 Length:525 Species:Homo sapiens


Alignment Length:68 Identity:19/68 - (27%)
Similarity:28/68 - (41%) Gaps:23/68 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 LAQTVEENGI------------DFEVVYDEQ----------VVGLGKLSLPKRLSTRIKLDMKAF 142
            :|.|||..||            ||.:.|:.:          :.||.|: |.....||..|:|:..
Human   207 IAATVENAGIILHIDNARLAADDFRLKYENELCLRQSVEADINGLRKV-LDDLTMTRSDLEMQIE 270

  Fly   143 SYT 145
            |:|
Human   271 SFT 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3199NP_650342.2 DUF4788 45..>216 CDD:406440 19/68 (28%)
KRT24NP_061889.2 Coil 1A 140..175
Linker 1 176..198
Coil 1B 199..290 19/68 (28%)
Linker 12 291..313
Coil 2 314..452
Tail 453..525
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 459..497
Head 1..139
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
Filament 140..452 CDD:459643 19/68 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.