DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3199 and KRT24

DIOPT Version :9

Sequence 1:NP_650342.2 Gene:CG3199 / 41725 FlyBaseID:FBgn0038210 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_061889.2 Gene:KRT24 / 192666 HGNCID:18527 Length:525 Species:Homo sapiens


Alignment Length:68 Identity:19/68 - (27%)
Similarity:28/68 - (41%) Gaps:23/68 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 LAQTVEENGI------------DFEVVYDEQ----------VVGLGKLSLPKRLSTRIKLDMKAF 142
            :|.|||..||            ||.:.|:.:          :.||.|: |.....||..|:|:..
Human   207 IAATVENAGIILHIDNARLAADDFRLKYENELCLRQSVEADINGLRKV-LDDLTMTRSDLEMQIE 270

  Fly   143 SYT 145
            |:|
Human   271 SFT 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3199NP_650342.2 DUF4788 45..>216 CDD:292651 19/68 (28%)
KRT24NP_061889.2 Head 1..139
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
Filament 140..452 CDD:278467 19/68 (28%)
Coil 1A 140..175
Linker 1 176..198
Coil 1B 199..290 19/68 (28%)
Linker 12 291..313
Coil 2 314..452
Tail 453..525
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 459..497
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M49
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.