DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3199 and Krt27

DIOPT Version :9

Sequence 1:NP_650342.2 Gene:CG3199 / 41725 FlyBaseID:FBgn0038210 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_034796.1 Gene:Krt27 / 16675 MGIID:1339999 Length:448 Species:Mus musculus


Alignment Length:200 Identity:47/200 - (23%)
Similarity:71/200 - (35%) Gaps:62/200 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 TRLEVKGVVLADARKLLVK----------VKFGGN-NLSLTASRTNVSEFKPNASHT-----FQA 95
            |.|||:...|::....|.|          ...||| |:.:.|:        |....|     .:|
Mouse   196 TDLEVQLETLSEELAYLKKNHEEEMQALQCAAGGNVNVEMNAA--------PGVDLTVLLNNMRA 252

  Fly    96 EPPNLAQTVEENGIDFEVVYDEQVVGLGKLSLPKRL--------STRIKL-DMKAFSYTSTCPLE 151
            |...||   |:|..|.|..:.|:     ..||.:::        |.|.:| :||....|    ||
Mouse   253 EYEALA---EQNRRDAEAWFQEK-----SASLQQQISDDAGATTSARNELTEMKRTLQT----LE 305

  Fly   152 MEGKPVGALEFLCKLFIKCGDYAREGETCPNLDRNLSPRDIVFVVGKSQANTSCCDPCRDALEIE 216
            :|.:.:.|:    |..::|.....||..|..|             .:.||..|..:.....:..|
Mouse   306 IELQSLLAM----KHSLECSLTETEGNYCTQL-------------AQIQAQISALEEQLHQVRTE 353

  Fly   217 ARKQK 221
            ...||
Mouse   354 TEGQK 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3199NP_650342.2 DUF4788 45..>216 CDD:292651 44/193 (23%)
Krt27NP_034796.1 Head. /evidence=ECO:0000255 1..73
Filament 73..386 CDD:278467 46/199 (23%)
Coil 1A. /evidence=ECO:0000255 74..109
Linker 1. /evidence=ECO:0000255 110..131
Coil 1B. /evidence=ECO:0000255 132..223 7/26 (27%)
Linker 12. /evidence=ECO:0000255 224..246 7/29 (24%)
Coil 2. /evidence=ECO:0000255 247..385 32/140 (23%)
YlqD 333..>376 CDD:287979 6/38 (16%)
Tail. /evidence=ECO:0000255 386..448
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 427..448
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M49
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.