DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3199 and Krt32

DIOPT Version :9

Sequence 1:NP_650342.2 Gene:CG3199 / 41725 FlyBaseID:FBgn0038210 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001152846.2 Gene:Krt32 / 16670 MGIID:1309995 Length:453 Species:Mus musculus


Alignment Length:217 Identity:42/217 - (19%)
Similarity:76/217 - (35%) Gaps:60/217 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 TRLEVKGVVLADA---RKLLVKVKFGGNNLSLTASRTNVSE----FKPNASH------------- 91
            |.|.::.:|.||.   |::|.::..  |...|.|...::.|    .|.|...             
Mouse   192 TELALRQLVEADTNGLRRILDELTL--NKADLEAQVESLKEELLCLKRNHEEEVGVLRQQLGDRL 254

  Fly    92 --TFQAEPP-NLAQTVEENGIDFEVVYD------EQVVGLGKLSLPKRLSTRIK---------LD 138
              ...|.|| :|.:.:||....:|.:.:      |:...:....|.|:::|..:         :|
Mouse   255 NIEVDAAPPVDLTRMLEEMRCQYETMVETNHRDVEEWFNMQMEELNKQVATSSEQLQSYQSDIID 319

  Fly   139 MKAFSYTSTCPLEMEGKPVGALEFLCKLFIKCGDYAREGETCPNLDRNLSPRDIVFVVGKSQANT 203
            ::....|....|:.:.....:||...            |||.......||....:....:||.:.
Mouse   320 LRRTVNTLEIELQAQHSLRDSLENTL------------GETEGRFTSQLSQMQCMITNVESQLSD 372

  Fly   204 SCCDPCRDALEIEARKQKDYSI 225
            ..||     ||   |:.::|.:
Mouse   373 IRCD-----LE---RQNQEYKV 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3199NP_650342.2 DUF4788 45..>216 CDD:292651 40/206 (19%)
Krt32NP_001152846.2 PMG 1..>92 CDD:283053
Filament 100..411 CDD:278467 42/217 (19%)
DUF4795 102..>256 CDD:292662 13/65 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M49
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.