DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3199 and Krt19

DIOPT Version :9

Sequence 1:NP_650342.2 Gene:CG3199 / 41725 FlyBaseID:FBgn0038210 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_032497.1 Gene:Krt19 / 16669 MGIID:96693 Length:403 Species:Mus musculus


Alignment Length:119 Identity:23/119 - (19%)
Similarity:52/119 - (43%) Gaps:20/119 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DKGKKGKKSVFRAKSTVVPTAPPEPVFDRNLPVFSFDLVITRLEV-------KGVVLADARKLLV 64
            :|.:|..::.:.|:...:.|         .:.|.|..:.|::.||       :|:.:....:|.:
Mouse   264 EKNRKDAEATYLARIEELNT---------QVAVHSEQIQISKTEVTDLRRTLQGLEIELQSQLSM 319

  Fly    65 KVKFGGNNLSLTASRTNV--SEFKPNASHTFQAEPPNLAQTVEENGIDFEVVYD 116
            |....| .|:.|.:|..|  |:.:...| .|:|:..::...:|....:::.:.|
Mouse   320 KAALEG-TLAETEARYGVQLSQIQSVIS-GFEAQLSDVRADIERQNQEYKQLMD 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3199NP_650342.2 DUF4788 45..>216 CDD:292651 17/81 (21%)
Krt19NP_032497.1 Head 1..82
Filament 82..393 CDD:278467 23/119 (19%)
Coil 1A 83..118
Linker 1 119..136
Coil 1B 137..228
Prefoldin 182..307 CDD:238453 9/51 (18%)
Linker 12 229..251
BAR 247..>402 CDD:299863 23/119 (19%)
Necessary for interaction with PNN. /evidence=ECO:0000250 247..393 23/119 (19%)
Coil 2 252..390 23/119 (19%)
Rod-like helical tail 391..403
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M49
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.