DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3199 and Krt16

DIOPT Version :10

Sequence 1:NP_650342.2 Gene:CG3199 / 41725 FlyBaseID:FBgn0038210 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001300887.1 Gene:Krt16 / 16666 MGIID:96690 Length:470 Species:Mus musculus


Alignment Length:83 Identity:18/83 - (21%)
Similarity:31/83 - (37%) Gaps:23/83 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 TNVSEFKP------------------NASHTFQAEPPNLA----QTVEENGIDFEVVYDEQVVGL 122
            |.:.::.|                  ||..|.|.:...||    :|..||.:......:..:.||
Mouse   155 TEIKDYSPYFKTIEDLKSKIIIATQENAQFTLQIDNARLAADDFRTKYENELFLRQSVEGDINGL 219

  Fly   123 GKLSLPKRLSTRIKLDMK 140
            .|: |.:...:|..|:|:
Mouse   220 RKV-LDELTLSRADLEMQ 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3199NP_650342.2 DUF4788 45..>216 CDD:406440 18/83 (22%)
Krt16NP_001300887.1 Head 1..112
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Filament 112..420 CDD:459643 18/83 (22%)
Coil 1A 113..148
Linker 1 149..166 2/10 (20%)
Coil 1B 167..258 16/71 (23%)
Linker 12 259..281
Coil 2 282..420
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.