DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3199 and Krt16

DIOPT Version :9

Sequence 1:NP_650342.2 Gene:CG3199 / 41725 FlyBaseID:FBgn0038210 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001300887.1 Gene:Krt16 / 16666 MGIID:96690 Length:470 Species:Mus musculus


Alignment Length:83 Identity:18/83 - (21%)
Similarity:31/83 - (37%) Gaps:23/83 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 TNVSEFKP------------------NASHTFQAEPPNLA----QTVEENGIDFEVVYDEQVVGL 122
            |.:.::.|                  ||..|.|.:...||    :|..||.:......:..:.||
Mouse   155 TEIKDYSPYFKTIEDLKSKIIIATQENAQFTLQIDNARLAADDFRTKYENELFLRQSVEGDINGL 219

  Fly   123 GKLSLPKRLSTRIKLDMK 140
            .|: |.:...:|..|:|:
Mouse   220 RKV-LDELTLSRADLEMQ 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3199NP_650342.2 DUF4788 45..>216 CDD:292651 18/83 (22%)
Krt16NP_001300887.1 Head 1..112
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Filament 112..420 CDD:278467 18/83 (22%)
Coil 1A 113..148
Linker 1 149..166 2/10 (20%)
Coil 1B 167..258 16/71 (23%)
Linker 12 259..281
Coil 2 282..420
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28M49
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.