DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3199 and Krt14

DIOPT Version :10

Sequence 1:NP_650342.2 Gene:CG3199 / 41725 FlyBaseID:FBgn0038210 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_058654.1 Gene:Krt14 / 16664 MGIID:96688 Length:484 Species:Mus musculus


Alignment Length:77 Identity:20/77 - (25%)
Similarity:37/77 - (48%) Gaps:14/77 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 VITRLEVKGVVLADARKLLVKVKFGGNNLSLTASR-TNVSEFKPNASHTFQAEPPNLAQTVEENG 108
            |.||||.:   :|..|:||     .|.:..|::|: ::.|:|...:..:......|  :.:....
Mouse   410 VKTRLEQE---IATYRRLL-----EGEDAHLSSSQFSSSSQFSSGSQSSRDVTSTN--RQIRTKV 464

  Fly   109 IDFEVVYDEQVV 120
            :|   |:|.:||
Mouse   465 MD---VHDGKVV 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3199NP_650342.2 DUF4788 45..>216 CDD:406440 20/77 (26%)
Krt14NP_058654.1 Head 1..120
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Filament 120..431 CDD:459643 10/28 (36%)
Coil 1A 121..156
Linker 1 157..174
Coil 1B 175..266
Linker 12 267..289
Coil 2 290..428 9/25 (36%)
Tail 429..484 10/50 (20%)
Interaction with Type I keratins and keratin filaments. /evidence=ECO:0000250 431..484 10/48 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 435..457 3/21 (14%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.