DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9722 and AT4G14730

DIOPT Version :9

Sequence 1:NP_650341.1 Gene:CG9722 / 41724 FlyBaseID:FBgn0038209 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_193209.2 Gene:AT4G14730 / 827126 AraportID:AT4G14730 Length:235 Species:Arabidopsis thaliana


Alignment Length:218 Identity:64/218 - (29%)
Similarity:123/218 - (56%) Gaps:9/218 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SASIRRGFIRKVYLILLAQLITSLVVIVSLTADKRVRLMVAESTWIFVVAILIVVFSLVALGCNE 111
            |:.:|..||||:|.||..||:.::.|...:...:.:...:.|:.....|..:|::..|:.|....
plant    21 SSELRWAFIRKLYSILSLQLLVTVGVSAVVYFVRPIPEFITETHRGLAVFFVILLLPLLLLWPLL 85

  Fly   112 DLRRQTPANFIFLSAFTIAESFLLGVAACRYAPMEIFMAVLITASVCLGLTLF---ALQTRYDFT 173
            ...::.|.|.|.||.||::.||.:|:.........:..|.::||.:..|||::   |::..:||:
plant    86 AFEKKHPINCIVLSIFTLSISFSVGICCSLSQGRIVLEAAILTAVMVFGLTIYTFWAVKRGHDFS 150

  Fly   174 VMGGLLVSCLIILLFFGIVTIFVG-GHMVTTIYASLSALLFSVYLVYDTQLMMGGKHRYSISPEE 237
            .:|..|...|:|:|.|.::.||.. |.:.:.|::.:::::|..|:::||..::     ..::.:|
plant   151 FLGPFLFGALLIILVFTLLQIFHPLGKLSSMIFSGIASIVFCGYIIFDTNQLI-----KKLNYDE 210

  Fly   238 YIFAALNIYMDVMNIFLDILQLI 260
            ||.||:.:|:||||:||.:|.:|
plant   211 YITAAIRLYLDVMNLFLSLLGII 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9722NP_650341.1 LFG_like 44..261 CDD:198410 64/218 (29%)
AT4G14730NP_193209.2 BI-1-like 9..235 CDD:320991 64/218 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 127 1.000 Domainoid score I1747
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 129 1.000 Inparanoid score I1887
OMA 1 1.010 - - QHG57711
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 1 1.000 - - mtm996
orthoMCL 1 0.900 - - OOG6_100360
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.780

Return to query results.
Submit another query.