DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9722 and BIL4

DIOPT Version :9

Sequence 1:NP_650341.1 Gene:CG9722 / 41724 FlyBaseID:FBgn0038209 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_191890.1 Gene:BIL4 / 825506 AraportID:AT3G63310 Length:239 Species:Arabidopsis thaliana


Alignment Length:222 Identity:69/222 - (31%)
Similarity:125/222 - (56%) Gaps:9/222 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SASIRRGFIRKVYLILLAQLITSLVVIVSLTADKRVRLMVAESTWIFVVAILIVVFSLVALGCNE 111
            |..:|..||||||.|:..||:.::.|..::.....:.:....:|..|.:.||:::..|:.:....
plant    22 SPELRWSFIRKVYSIISIQLLVTIAVAATVVKVHSISVFFTTTTAGFALYILLILTPLIVMCPLY 86

  Fly   112 DLRRQTPANFIFLSAFTIAESFLLGVAACRYAPMEIFMAVLITASVCLGLTLF---ALQTRYDFT 173
            ...::.|.|::.|..||:|.:|.:|:.....:...|..:|::||.|.:.|||:   |.:..:||.
plant    87 YYHQKHPVNYLLLGIFTVALAFAVGLTCAFTSGKVILESVILTAVVVISLTLYTFWAAKRGHDFN 151

  Fly   174 VMGGLLVSCLIILLFFGIVTI-FVGGHMVTTIYASLSALLFSVYLVYDTQLMMGGKHRYSISPEE 237
            .:|..|...:|:|:.|..:.| |..|.:...||..|::::|..|:||||..:: .:|.|    :|
plant   152 FLGPFLFGAVIVLMVFSFIQILFPLGKISVMIYGCLASIIFCGYIVYDTDNLI-KRHSY----DE 211

  Fly   238 YIFAALNIYMDVMNIFLDILQLIGGSD 264
            ||:||:::|:||:|:||.:|.|:...|
plant   212 YIWAAVSLYLDVINLFLSLLTLLRAVD 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9722NP_650341.1 LFG_like 44..261 CDD:198410 68/217 (31%)
BIL4NP_191890.1 BI-1-like 22..225 CDD:320991 63/207 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 127 1.000 Domainoid score I1747
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 129 1.000 Inparanoid score I1887
OMA 1 1.010 - - QHG57711
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 1 1.000 - - mtm996
orthoMCL 1 0.900 - - OOG6_100360
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.780

Return to query results.
Submit another query.