DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9722 and Tmbim4

DIOPT Version :9

Sequence 1:NP_650341.1 Gene:CG9722 / 41724 FlyBaseID:FBgn0038209 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_080893.1 Gene:Tmbim4 / 68212 MGIID:1915462 Length:238 Species:Mus musculus


Alignment Length:230 Identity:87/230 - (37%)
Similarity:127/230 - (55%) Gaps:16/230 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 QDDPDKGLGFCSAS--IRRGFIRKVYLILLAQLITSLVVIVSLTADKRVRLMVAESTWIFVVAIL 98
            :||.:.|....|||  ||..|:||||.||..|::.:.|........:.:|..|.||      ..|
Mouse    14 EDDFNYGSCVASASVHIRMAFLRKVYSILSLQVLLTTVTSALFLYFQALRTFVHES------PAL 72

  Fly    99 IVVFSLVALGC--NEDLRRQT-PANFIFLSAFTIAESFLLGVAACRYAPMEIFMAVLITASVCLG 160
            ||||:|.:||.  ...|.|.| |.|...|.|||::||..:......|....:..|.::|.:|.||
Mouse    73 IVVFALGSLGLIFALTLHRHTHPLNLYLLFAFTLSESLAVAAVVTFYDVYLVLQAFIMTTAVFLG 137

  Fly   161 LTLFALQTRYDFTVMGGLLVSCLIILLFFGIVTIFVGGHMVTTIYASLSALLFSVYLVYDTQLMM 225
            ||.:.||::.|||..|..|.:.|.||...|.:.:|.....:..:.|||.||||..:::|||..:|
Mouse   138 LTAYTLQSKRDFTKFGAGLFAGLWILCLAGFLKLFFYSETMELVLASLGALLFCGFIIYDTHSLM 202

  Fly   226 GGKHRYSISPEEYIFAALNIYMDVMNIFLDILQLI 260
               ||  :|||||:.||:::|||::|:||.:|:.:
Mouse   203 ---HR--LSPEEYVIAAISLYMDIINLFLHLLKFL 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9722NP_650341.1 LFG_like 44..261 CDD:198410 84/222 (38%)
Tmbim4NP_080893.1 GAAP_like 8..236 CDD:198411 87/230 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0670
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57711
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100360
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.730

Return to query results.
Submit another query.