DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9722 and LOC566927

DIOPT Version :9

Sequence 1:NP_650341.1 Gene:CG9722 / 41724 FlyBaseID:FBgn0038209 Length:264 Species:Drosophila melanogaster
Sequence 2:XP_017213252.1 Gene:LOC566927 / 566927 -ID:- Length:236 Species:Danio rerio


Alignment Length:140 Identity:54/140 - (38%)
Similarity:83/140 - (59%) Gaps:2/140 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SASIRRGFIRKVYLILLAQL-ITSLVVIVSLTADKRVRLMVAESTWIFVVAILIVVFSLVALGCN 110
            |.|:|..|||||||||.||| |||.::.|....:. |||.|.::..::..:..|.:.:.:.|.|.
Zfish    96 SMSVRHAFIRKVYLILAAQLFITSSIIAVFAFVEP-VRLFVIQNPALYWASFPIYLVTYLMLVCC 159

  Fly   111 EDLRRQTPANFIFLSAFTIAESFLLGVAACRYAPMEIFMAVLITASVCLGLTLFALQTRYDFTVM 175
            |..||:.|.|.|.|..||:..|::.|..:..:....:|:|:.|||.||:.:|:|:.||:.|||..
Zfish   160 EGPRRRHPWNLILLFIFTLTLSYMTGTISSYFDTKAVFLALGITAIVCVIVTVFSFQTKVDFTSC 224

  Fly   176 GGLLVSCLII 185
            .|||.:..::
Zfish   225 TGLLCALCVV 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9722NP_650341.1 LFG_like 44..261 CDD:198410 54/140 (39%)
LOC566927XP_017213252.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1290306at2759
OrthoFinder 1 1.000 - - FOG0000200
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X332
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.