DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9722 and Mics1

DIOPT Version :9

Sequence 1:NP_650341.1 Gene:CG9722 / 41724 FlyBaseID:FBgn0038209 Length:264 Species:Drosophila melanogaster
Sequence 2:NP_649725.2 Gene:Mics1 / 40898 FlyBaseID:FBgn0037506 Length:365 Species:Drosophila melanogaster


Alignment Length:231 Identity:60/231 - (25%)
Similarity:95/231 - (41%) Gaps:63/231 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 ITSLVVIVSLTADKRVRLMVAESTWIFVVAILIVVFSLVALGCNEDLRRQTPANFIFLSAFTIAE 131
            :|:...:....:|..:.|| ..|.|         |.|||.||            .:.||. :||:
  Fly   157 VTAASAVAFFQSDAMMALM-TRSGW---------VASLVTLG------------LVMLSG-SIAQ 198

  Fly   132 SF------------------LLGVAACRYAPMEIF------MAVLITASVCLGL-TLFALQTRYD 171
            ..                  :||..   .|||.:.      .|:|.|:.:...| |:.|......
  Fly   199 GLEYQPGFGAKQLAWLVHCAVLGAV---LAPMCLLGGPILTKALLYTSGIVGALSTVAACAPSEK 260

  Fly   172 FTVMGGLLVSCLIILLFFGIVTIF------VGGHMVT-TIYASLSALLFSVYLVYDTQLMMGGKH 229
            |..|||.|...|.::....:.:::      ||..:.: ::|..|  :|||.:|:||||.::....
  Fly   261 FLHMGGPLAIGLGVVFASSLASMWLPPTTAVGAGLASMSLYGGL--ILFSGFLLYDTQRIVKSAE 323

  Fly   230 ---RYSISPEEYIFAALNIYMDVMNIFLDILQLIGG 262
               :||..|.:.|..||.||||.:|||:.|..::.|
  Fly   324 LYPQYSKFPYDPINHALAIYMDALNIFIRIAIILAG 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9722NP_650341.1 LFG_like 44..261 CDD:198410 59/228 (26%)
Mics1NP_649725.2 GHITM 116..364 CDD:198413 60/231 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439716
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23291
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.